SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190504 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190504
Domain Number 1 Region: 298-478
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-50
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 171-320
Classification Level Classification E-value
Superfamily NHL repeat 0.0000149
Family NHL repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190504
Sequence length 607
Sequence
MQYVLLMLALPFFDASGQVSPDFNLTEQPLCRLVVSWLLEQNIDKTSDEQLRFFLFLNPD
NKLIDCSEELPDRKLNNSNIVKDYKKKCSKKPSLKDKRNSLQHQRQNSSSGTKSPQPPLH
QSEDEDDVSTSMVASAVVADKSFICLAVLDQRLVSVSIKFQSDENVRKMSSGDDDNTTDE
VIMTVDRNQPQCLMTHLSSMSTARCGFGVGVANGNIIAVGGYDRGECFNTAEIYSPITNL
WCPIKPMSTLRGRFSASMLNGKLYACGGSNGTNELNSIEAYDVASDTWINVPDMAIRRSG
AGVAVCGNKLFVVGGLCGSKTLSSCEMYDPAANKWTNVANLSTGRSQAAVCSYGETSIVA
LGGCDAWNFMNTCECYDPLTDTWSFLPSLVVARRGAGAAYFKGMLFVVGGSNEQTTLTSV
EIFDPDNNCWFAGPSLGIPRSIMGVTVLEGNRLFVIGGFSGKNFLKSLECLSYDSDEFCS
YLPAGSDIESIMRADSIRKFKFQNCMSSRSSHTSSTYSDSPKSPQLDDVANTVTRNINSD
SEISSSCSLEDLNKDYHFNHHSTTSSAFGDNKMVNGTAAAAASSLAGDASLSNGGGCGEI
SGNHVDL
Download sequence
Identical sequences T1FS19
jgi|Helro1|190504 XP_009012557.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]