SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|190982 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|190982
Domain Number 1 Region: 308-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000157
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 2 Region: 668-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000215
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 550-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000249
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 588-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000369
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 5 Region: 346-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000254
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 6 Region: 703-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000032
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 422-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 8 Region: 271-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000371
Family EGF-type module 0.03
Further Details:      
 
Domain Number 9 Region: 232-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000351
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 627-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000449
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 390-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000158
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|190982
Domain Number - Region: 457-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000132
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 515-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.002
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|190982
Sequence length 1247
Sequence
MAMHFKSISFWHSKETCEFYVGTDADSYLIERAHYSGVILPRSEWQTMSFAGHTAILKYK
IRVQCDLHHFNVTCTKFCRPRNDTFGHYTCDSNGDKVCLNGWIGTNCETDKSSNDMMMRE
GKRLEMKMFIVKLQKGTLKTTNVKILKIEDEHFTSGCYRLILPPPSFTLIILFLVFFRGI
NNEQTLNGWEGELCGQCSKHPGCKHGTCRTSPWECHCEPNWGGPLCDKDLNYCGRHSPCL
NGGLCINKAPDDYQCQCLNAFEGRNCEIARYQACSKRPCQNGGSCVLKGVQLLCQCTEGW
AGEMCQINVDECSSNPCQHGGTCIDGVAGYQCICPSQWQGGRCEHDADECIKFPCLNARS
CQNIVGDYLCHCIEGWTGRNCDISLYGCKKGCHNNGKCMKAVVGYSCVCKEGFTGSQCES
AISKCSSQPCQNSGTCRDGPAGAYRCMCPEGYSGPNCELQRDPCEPNPCQNYSPCHRQGS
SYLCECSDCYTGPTCSVKKENCGHSNHKDICAYPTSSSSCGKHGNCIRSSAGVQKCVCDA
GFTGLHCHENINDCANNPCMNMGTCVDGVNNFQCICSDGWEGHLCNIDQNDCSPNPCRNG
GTCIDMLAGFKCLCREGWKGRTCSSKVSHCDSQTCLMGGTCVELHDTFKCLCPNNLHGDI
CQSVINTSCRTNPCQNGATCVNTGDTFTCLCVEGFTGTSCEINVNDCNPYPCYNNGQCVD
GVNWYQCRCLDGFTGHDCKTVVGNLSLASKSCLFQSSMYAHNFRWTSDCNSCVCYDGLVQ
CTNIWCGPSSCHLNHPTSPHSNSSSQLACGPDEICVVQSESRCFTPPCSLIGECRHMINI
GQSKIISSSDENIINMKCRPNLLVTSRACVRMMLTFDRKHAPQGVTVDDVCRIIRNISAL
NGMTTGETLVILCDVQLDDADTIESLLEPHNLSEDDVMKYSHQMANDIEEVIKRKESNWT
LFSSVVRVRLEDFTTNEGNSLDLPVYLIPLVTAIIVLAGIIAIILLVFWHRKFVRRCRQK
KEQTDALMKLDAPPNNDCQLNKLNNLNNNNNNNNNNNINNNNNNNNNNNNNNSYKSCSNS
QRELQPLNRHHNQIHSNADNDDAIRNNKVNWDKALKSKKNVDKKQNNLPSAGPCDMKMET
YDDSPAQRPHKIKQINVKLNKDNVIKNINTSSSSSSSKSSSSSSMHENNTAALEFKPSNN
KKFNCERDSYAEDCSEDTKLKNRILLSDPNKDINTDVKFSPNYDVIL
Download sequence
Identical sequences T1FSH0
jgi|Helro1|190982 XP_009014186.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]