SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|191240 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|191240
Domain Number - Region: 95-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0144
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|191240
Sequence length 528
Sequence
MYVKKVQQYCFPWHFNASCGPDEMIMMTSAMYGRSSKGRCSGRRSCHVVTPDPILYQLKP
CPNDFSVSLEADYSCVKVEMGKPYTCNHFGDPQIVNEPRGYLASLVVEELKIGGPRCPWM
ITASRGQQINFTLHDYGVALRRDDVISIQTMASPQSLIRHENELHLLQAYHDARHRTRRN
QLEHAPSCKVYVTLRDVEARSANSAIIDVADCTSKERIRHVMLSEGPKVEVTMMDLKVKE
EIIYYALHFEAVGCADPIVPRGAHLRRNGIQATITCNFTIQSWHIVCQGDGWYGSVDNCT
VETPTKSSMVLNDSTEIYPLDYKNKGGGTIKAGSTSVDALGHVEVVVPNDLEGGGLSLLV
AVMVGLVLGVLIGVVLLTLVLSCHKKLYSKKRLREAKELSSQRVLYSTRRDVINDNDDDN
YNADSNNINNYAPTTTSTPNYHHLHTNNNNTNNNTTSTTTYCPSYHYSPGNGFGSTGSTL
LAGRNYLDFQDGIRYTHVCGLGAMDVVPPCERNESNNNNVCNDNRQAS
Download sequence
Identical sequences T1FSS2
jgi|Helro1|191240 XP_009015004.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]