SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|67485 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|67485
Domain Number 1 Region: 90-265
Classification Level Classification E-value
Superfamily vWA-like 1.53e-25
Family Integrin A (or I) domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|67485
Sequence length 418
Sequence
VNLTQSTVHVPTNVYDESASVLNGVAFSEALDDVFNSNRKSFSTISWQFYCSFVGFFRIY
PGISWGNSDEADQFDCRTRLWYIQAATSSKDVIILVDTSGSMTGLRIEIAKSTVIKILDT
FNEDDYFNVISFSDEPDYFEPCYNNSLVQATVRNKQIFTKVLCSLFTSYVVKLYKIFNIY
LKNNFNSLGSKCNKVIMLITDGSPSDFREVFEKYNFPDKKVRVFTYLIGREIRDTTQLKW
MACNNKGQLMCYFSHISTLADVYEHVQDYIRVLSRPLVIGRYPQKVWTNIYGNERTNELT
TTVAMPVYDIKNASYNDGNLLGVIGTDMLLDVLTNVLPKHQLGVQNYPFAITNNGFIIFH
PDHRPYHNGKLKPNYNNLDISEVEFIDDGKIRQSMVKGETGKTRLRVKVALDEMVTHE
Download sequence
Identical sequences T1FZ15
XP_009022577.1.102002 jgi|Helro1|67485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]