SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|71602 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|71602
Domain Number 1 Region: 11-174
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.06e-47
Family BAR domain 0.00000593
Further Details:      
 
Domain Number 2 Region: 292-349
Classification Level Classification E-value
Superfamily SH3-domain 1.3e-23
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|71602
Sequence length 353
Sequence
MSLAGFKKQINKANQYVSEKIGGAKGTELDEEFMEMEKRTDAMVRLVDDLMVKTHEMLQP
NPASRARMLAVKSISKLRGTSNHTLYPQPEGQLGESMVKYGKELGEDSFFGQALFEAGET
YKQIAEMKYLKEDTVKQNFTEPLLHLQNKDLKEVNHHRKKLHGRRLDFDCKKRRGILSKV
LHLKRCEVYKVTFSLKIIEKIHNNIGYGTVFRVLVHIPLKLHSQTFNQLTLQKLEIKSKQ
CAEASSRPKKEYVPKKILSTNKLNVNDGGSGFKSNSRPNSRSASPVNSALKISGPSCEAL
YDFDAENDGELGFKEGDVIQLLSRIDENWFEGQINGQIGYFPTNYVKVLVELP
Download sequence
Identical sequences T1G0N9
jgi|Helro1|71602 XP_009010052.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]