SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|86858 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|86858
Domain Number 1 Region: 98-149
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000011
Family Ovomucoid domain III-like 0.0044
Further Details:      
 
Domain Number 2 Region: 41-92
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000846
Family Ovomucoid domain III-like 0.0069
Further Details:      
 
Domain Number 3 Region: 212-261
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000018
Family Ovomucoid domain III-like 0.0036
Further Details:      
 
Domain Number 4 Region: 146-203
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000025
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 5 Region: 4-40
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000277
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|86858
Sequence length 278
Sequence
DDASTLCGSDGNDYEDVCEMRNINCRKEDHVTVKFSGRCETRQPYCDCGTLCPMTIEPVC
GSDGRTYINECFLKERACARNDDVIVQFSGECSSDYTNTAHCTCPQHCPAVYRPVCGSDG
LTYDSECHLKLFACNKNLNLLVNREGVCRQCENGACTCTFACPNERKEEVCGDNGKTYPN
ECFMNKSSCKGNVDVRLAYHGKCKPKDGYNAQKMCVCHFNCPLYKNLICGSDNKTYDNEC
ELKEASCKTQKPISVKYQGSCAGCSASFTHYDYFHLSC
Download sequence
Identical sequences T1G6I4
XP_009026480.1.102002 jgi|Helro1|86858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]