SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 129.m00112 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  129.m00112
Domain Number - Region: 7-121
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000645
Family Ricin B-like 0.034
Further Details:      
 
Domain Number - Region: 205-283
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00978
Family Ricin B-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 129.m00112
Sequence length 311
Comment hypothetical protein
Sequence
MQKQELIVTIRPAYNPTHYLFPANDGSRAYNQDFDVRTHASQEQRNQLILTRVKDNVFTI
KSATNPTHYMFASNDSHRSDGKDFDVRTHASDEERNQWIIEEYAQGFHIRVYTNPTHYLF
PANDGSNGLGADFDVRTHPHKEERNLWFIDGLIYAPPTQKTTLRVKANPNHFMFASNDGV
RGLNKDFDVRTHASSEERNFILIHHVGHHVYTLASATNPNHFFFPSDDGTRAYAHDFDVR
THTYQEERNKWIIESDNQGGFFIRSFVKPQHYLFAANDGSNSYGGDFDVRTHASQEARNA
WIIDGFVLHNY
Download sequence
Identical sequences Q23WS8
129.m00112 XP_001021262.1.55412 5911.XP_001021262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]