SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1617.m00002 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1617.m00002
Domain Number 1 Region: 33-226
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.96e-27
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1617.m00002
Sequence length 233
Comment P-type ATPase
Sequence
MQQNILVKQKEALVNAYKVTCILADKTGTITMNQLTITHLFYGQNLFKTAENNFDEGENF
NPDDQDFQNLYKNAALSCNAKFVLEGDQNNVDYSTCKMLGGVSDQALLRFLHSIKNVDNF
KKSIQYAKNIEGKAAKLELNSINKYKFSIVEEEVEDSHYVVYFEGAAEKIISLCQFYMKN
NSKLEIDSAFKENVLNCLEQLGKKSERVLGFAKLHLPASQFPKGHIYLFLLKN
Download sequence
Identical sequences 1617.m00002 5911.XP_001028399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]