SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 17.m00458 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  17.m00458
Domain Number - Region: 5-47
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0112
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 17.m00458
Sequence length 50
Comment hypothetical protein
Sequence
MSKLEGKNMKQQEINQLIIKEKGENKKMSQISKQRRKKVVPQNEKQKAIK
Download sequence
Identical sequences 5911.XP_001007164 17.m00458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]