SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3688.m00056 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3688.m00056
Domain Number 1 Region: 177-442
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.86e-82
Family Protein kinases, catalytic subunit 0.00000314
Further Details:      
 
Weak hits

Sequence:  3688.m00056
Domain Number - Region: 93-137
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3688.m00056
Sequence length 468
Comment Protein kinase domain containing protein
Sequence
MGGKGSKNNNEEEIQEGKPFNFQKHISIQVDQNGKLINVPEEWKKYGLGLDIDETKTVKT
KKMPEVVRFENELPENIQELISMLSLTVSKPENFARVHHIEIDPSAPYGLKGLPPEWEER
FKVQGINTEEVKENPQNMISIINNYDQGIEAPKKIILPTNDEFLKIVENIGLQEDDPSKF
YNFGDKLGKGAMCQVFKATKRKTKNEEFAVRVMKLGDEGSMNKIKIEMAIMKICQHKNIV
RYYETFKFMSCLFMVIEYMNGGSLTEIIYQNFKTIPEDIIAYILREIIQGLNFIHLQNQA
HRDLKSDNILVNKNGEVKVADFGFATQLTQEKQRRKSVVGTPAWMAPELILKKEYNEKVD
VWSTGIIAIELAMGEPPHLRMPPLKAMYTISSKAPPRLDPANFTQNFCNFVEQCLQKNPD
ERASFQTLLEHPFLKNVPADAASKFASMVQNKKNIPLNQLFNIPKDKQ
Download sequence
Identical sequences I7M8K4
5911.XP_001018594 XP_001018594.1.55412 3688.m00056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]