SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3825.m02618 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3825.m02618
Domain Number 1 Region: 1855-2059
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000368
Family Galacturonase 0.062
Further Details:      
 
Domain Number 2 Region: 62-251,559-680
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000141
Family YVTN repeat 0.068
Further Details:      
 
Weak hits

Sequence:  3825.m02618
Domain Number - Region: 1394-1617
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000224
Family Galacturonase 0.043
Further Details:      
 
Domain Number - Region: 1010-1107,1158-1207
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0455
Family Galacturonase 0.059
Further Details:      
 
Domain Number - Region: 452-537
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0815
Family GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3825.m02618
Sequence length 2512
Comment hypothetical protein
Sequence
MSPFSFVMKNKKQADFIEASEDPKQCLDIQRYYNKKQNYTFRDVIELTGSNTIILRASSN
SGDGNFIQIVDQQTSQVLHSFSIDSSLRQTIYFKKKNKLYTISQDKLVERHIQYFDVIKQ
YQIPNIVSIEDIEDSQNEILILSRDQRAFRFNLNTEEVSKKYPLSLEGQKYAIQNGFVKI
ITLKDYQIFARGGKHAIEIYATSFNEDIPIIQLFQREYVKKNSLFDQSDIVGIDGTNLIA
IQSSLQEILIMEIYLDKQENKIKAMEKFKKSIFNFFPTRIFYMNKQMNHNLVVFYQQSST
EQIQFEVFVYQIIIDYSKDQSIKIQLKVIEIWTIQQLVKEDFSVLNYLPQSMRVYGIMND
QHLSYELLDGDGFECDYDGDGQLDFYCRVPKILRFRKWDQSIGIFYLKDNRILIPNSFYG
LLEIRNSNLLEIETIKAPYFQYQKVEGLLNEQSQINGDKNLKWNFQDEQSKPNKSNRILY
ENQKNDTFMWYQENQYENQMFMIYDTKEIREFSIKQYFDIEYKKYLNKNIVAMYSYDNIF
VGCIAFYYPDFGNIIGIKNLNTQKLQKVRTYFQFHNLECYEIDDAKNTVKKYNLYSEKIQ
ILSDKQNIMDCTINQQSNHFICKNNNSQLLFWSLLDFSFIQIREVLQCIETTQLVAYQNF
IYMNCVHFGTVIQFDINTNNTKIIANKSSSYLQLIKNGQFLIASAPLSPGFMIFDVTKPA
NSPPLFQIEDKNVCCQNVYIEYDDATHKVAVIGSNLLMIVDLKQCIIQDDNQEYIFDFGS
CMQCTMDAFISYIPSQNFTYYRNSPIRQNNLEQKISKNIFNPTFLSIGNGNLENPFASDL
QIIEFYLRVEVFKNILAGFNQVKLRIFIDSTKVNPLNKYFFEWTQEKSIIEVLSFKPQEY
LKEQRETQNLKSNDKYDEDLNNYSPAYITIRQKQDIKIKYWNSLYFHHINVICTQCIDNL
NISISYMVDLYLNNVQFLTYDGDDENNVEDIINEINKLSSDQKPVKGQKNNTVLTGEEQS
QNGNKVKYIYPTFFLKKIDNTTIYSLKIENLNIQQAIMNFQSCQKVQLRNLNFNNNIVSS
EIITSQQTYLKLVYCQFSNNNFINPRSITTSRPQTFNPTVQLIDPDQTAQETSNRRLLQL
KQAHQNRFIENQQFSIKTTFIFKNITFSQNAYDLINLPKVIFIQILLEVFLVAQHDVIMD
NITILENYQTYYEGSYDLKSYDSFYIQLSMIRVLNLSNVYMKYENVAGLIETKMVNFVNI
QNFCYNDIFEFQDQVRKRYLKLIKSKEAEANQKNEYIFQEKKDQNFQQIDFQKVNENSFK
QLNRMKNRIFQQNIEVENKDQPPQDNDKNKEVRNEKVTEKEEQNEQEKYKEEEKEKQEGE
GDKNYVYFGPVRETIEVNFKNITVSYLHFINTVVINIFNREKELRFIQFQECKFNQIQLT
STYHYIQVNLIQILAQNSNANIQVDNNLFSNLIIFFNQNSDLKSSSGLTIQSLKSKAVFN
NNTFANTSSNSVIGALSLDVSSLTFTNCTFDNNIYYGMELSNNEIFSLNIGGFIAAKVDT
ISLTDTHFKKTFSSQGAIQIKSNQNKLEVSILKCTFKEIFAFSSSGSVLNVDSSQSILQM
VIQESTFENIVQITNQYTYQKLKAVIYIEKDYSFQNDLNFVQFDQVDITNVITQFIEQKQ
NYFFNSFQSSFNSFFFIGSIINVQAQQFNIKSDRKYKELIEFLQYIEQFQHQKLQFNDKD
KLKEQIMHSPIFYLEEGEISLQNITYYGNREEVTNITNKFSQNNIHENLFKYKKTLIVAT
QSTVRISNLSAINLLVTKFIDVKDSEKVELKQLFFERVEQLLIKDLLTSNLEKIGQSAII
NLKKIQNISIENLEIYCDQNQLSQQSQQNQINNEQQQLHCLGQVIFIQESQFDIKNSIIH
NYVSPIHNGTAISILNPNNSCTIKNNRFYYLKTSGYGGAIYIQMTNQGFDFKDYFYNYIQ
DSKQILNINLEGNTFQFNQAEKGGCIFFENLLDITDRIKFQISQNKFYNNTSRLGSSLYY
QNIVPYIETNNKFKYNSDDISKSTIFSTPHLIKLVQTDEIKQILNFNSSLHWNDKNSEYI
ADIIIASGQKLPALKFQFYFIHDFSQEINLVHLDLIQTDIPIQEYINIELSYDPSQQNSN
LANPLSPFMFFLRNKDEIKYEKEGNYIEFSNLQLLGVFNQSITLQVSSPLIMHENKRLNQ
IEKNIKFKINVFFRQCNKYEITTKTDFLPSEMSNQIMQCYKCLDNTFARDGSVCSECPQG
AVCKQEHEIQISPGYWRKSLSSYEIIQCFNELGNCRGGNSFGNQLCQEGYVGALCEECDL
FAEVWPHSYTRQGNFKCVRCNKQGFSYFLIILSHILTLIVAISSIVSNSESIKIKRKSNK
PNRSANNLDQYNKQDIKQIQSGANLKILASYFSLMSCMSNFKFSLPRIIPEVSGVVGSPI
AISMNAIDCLLGDLVYEAINLIACRNIAGEKYLLANYILHLSYYHYYFLSAY
Download sequence
Identical sequences 5911.XP_976897 3825.m02618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]