SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 112.m00147 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  112.m00147
Domain Number 1 Region: 889-999
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-17
Family Pleckstrin-homology domain (PH domain) 0.069
Further Details:      
 
Weak hits

Sequence:  112.m00147
Domain Number - Region: 38-103,198-232
Classification Level Classification E-value
Superfamily EF-hand 0.00456
Family Calmodulin-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 112.m00147
Sequence length 1022
Comment PH domain containing protein
Sequence
MRLVQFKGQCIYNYAEEIQSNAGSDDIGQVSFKFNNNIFDISPKYENDFITFDQFKEIIN
QMAKIDSRCEFNDEVIQQLYDFVFYKQNGQVCFGAVVGLTLEILKERTSYTPAQTQEFEV
QNPNHKTLWQQVLLVIDQLTSDTLHQMKYIYEQCVEDLYSSQDGDSDEDGLGKKKSMDPT
NGVDLDFIAQKVEQMNSLNQSEKENIDFLFKCIQDDQGRVTHASLGDLMSLLEQYWISLV
QQQAGESQQAQSNRGSTVIQNTQKVNSLTRLEDDDDQQSKNKKDEQDQQDESKQYYKYDY
MQDLVHKVDQLKQMKGQKSSFYEIVDDMFNNLLLLGTKLDSYEMELEQQTKKSAKQQNET
MKLEQKVTYLETEMKRVIEYKDDLEAQFDDLTKEYDILEQKYTIKEQTEKENQKALENVS
KLETQCAQYSRKQKELEQKNEQLKLENADLKQESDKMYGLFQQAQEELDQIKQQLSQNQT
TQALNNFEQQNKNQTDQVLLQKLKDENRAIQMKLQILNDEAKKYKLQFESREEEYQELQR
VHKQLMVQYEEACIVARDKPLRLFNNDGTGRKSTRYSIKPLSGGFGRQSVNKQARPSIQF
GNNNKTSLIGFDNNQNQDQNNRISFNYSTRGSVFNEEIKQSNGNNFYLNSENSIRSSVMS
GRQSVNFDKFWDQFQNRMSIANQTGQLQKQTSQNDNQPASSQVLDPSHPQYYANFLAFDE
NELYARDFLNLRDHKKIQQILDKYSDVDNPNEMKCFSDSIYRINNSNERERRILFATPYN
IFILHPKTHKVIRRIQIDRITKITFLNKSAYLCVISIKQEYDYLIETYRRADFNMFLMQT
IKERQLAPYKIQFADEINIQFRGIKDKINIGQMDEKTLLNRFQASFKSAQMVGFLEICKH
NWIKDFFSEPWKEYFFVLSNIGLVSFAKPGDSKPLLFIPINDALVIKDPAGQEKKFCIKI
FYQNSNQHYILACQSKADQDKWLDSIRKVIYQSVNINAKRDQIMKSQYLDPKDVIQEQDD
EN
Download sequence
Identical sequences 5911.XP_001025903 112.m00147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]