SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 217.m00031 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  217.m00031
Domain Number 1 Region: 383-507
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000175
Family Ricin B-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 217.m00031
Sequence length 520
Comment MAC/Perforin domain containing protein
Sequence
MNIFKTKFTICLLLVLQIICAQQSDQTISWKQSISPGQIKYIPNVSYLGQGYNIFQGNPL
STSGIDPGFRNVPAVDLLYQDNLWDAASPDRAYFIPDGVRVNIEKSCLITFSSKQVSTLT
DYQNSLSAKVSGKGSVFSASFSASADFKQMKDTLSQKDTQCIQSHATCTAFDLSFYNDIN
SLPLLSLQLVDKIQQLYSYSNYTNEKEYYYDFFDSWGTHVATSVRLGSLFGYQFKMSSSS
VQQQSSLGFDASVGASLYGVKGKVSTSYAQQQLNSFQQSLKSWSSYSLGATPNANLDAAQ
WATQTLDTPMPIKTELTPIYTFISQYQNNADIPLNSTTMAYVVNAMQNYIGQYCYDRLQF
STALNSCSGYVNQSSDPYVGQSKIMNTKSGKFVSFDQNTLKVFQLTNNSTTSNQQMYTVT
RPTNNQNIYQIQTSNYNYCLGVSVAQDGQPLVLKNCALDSLTLFEIDEIGQGFQYLKLMG
SNYYMTVQSTASISDTSDNALIVLSQNQNACRGCTFFQVD
Download sequence
Identical sequences Q22CA7
5911.XP_001030563 XP_001030563.1.55412 217.m00031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]