SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 22.m00204 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  22.m00204
Domain Number 1 Region: 399-516
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.32e-18
Family Ricin B-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 22.m00204
Sequence length 518
Comment MAC/Perforin domain containing protein
Sequence
MNKRQKTVFLVFILLIGQCQAGYLRGQDQTILWNNTIDPASIGYIPNVQYLGSGYNIYFA
NPHSTTGLDPGFTNSGILELDYNNNLWTNINPDRSYYVPDNVSLTVEKSCIVSFQSQEVN
SLSQYRDSLSSSVQFQAKYFAGKFSASSDYQEVQDGLNSANIQYIESQARCSIFQLDVYN
SPSQNAQLTPQLQQALFTLAFNQTSQNDYYDFIDTWGTHVVTSVNLGSRFGYKYQMDKYQ
SNQLTQQGVNLSVSASYFSSSGSASGAYNQTQIQNFTQAMTSWSSYSIGATPDANQDPLS
WAQQTLDTPMPINISILSFDDFLNKFSFSVNGLTSSQLNTVISNLSQYLQTYCANRLLVN
GKIDACADQEVSSSQIFQYSNNTFKIQNFLSNNYIQGQNGQNITSAVLFTKNPNINIAQP
DFQQFKMQIQSSNTVSFIQKQGGECITYSSSQNNSTLTLQSCNGSQNQQFQVIDIAPSLF
YIKSTMNNLYFTSQGSYFQMQQLQSCLGCQVFNLAYII
Download sequence
Identical sequences Q23QV5
XP_001019028.1.55412 5911.XP_001019028 22.m00204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]