SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 23.m00229 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  23.m00229
Domain Number 1 Region: 334-412
Classification Level Classification E-value
Superfamily PH domain-like 0.0000328
Family Ran-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 23.m00229
Sequence length 414
Comment hypothetical protein
Sequence
MSKRRAPYELDQNNLSDDEHAAPDLGKISTPEEIAQRRILKIKGPKSEESTTPAKLVLLE
KLEDAQPAANNNGNHANEAKEGTNGDKIEEKKIEFSTSSSLFAKTDATNGNNKHTENKEE
SKPEQSEKETEKVSEPAKEKTTNDTSLFGSIKPSSATSGLFGNTSTTGGLFGKSTGTGTL
FGNSNSLFTPSSGTGLFSNANKVEGGQTIQNIFNTDKPTGSLFGSLPTSNATSLFGNAKP
AESSSLFGDLKNNTTGGLFSNIKSKGSDDEGDEGEGEDDDELEHSPEIDPSQIQMKYQYD
NPYEKVIDKSVLKVRRGDGDILEKGYISFEKFKADDKTPNILVYRDQIKKVIFTIVVTKK
INKAEKIQNSTKNLKFIFYKKQDEKFVPDIIKVQFHDEKDGEEFYNKFQEYTQN
Download sequence
Identical sequences Q22UB5
5911.XP_001009017 XP_001009017.2.55412 23.m00229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]