SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3703.m00079 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3703.m00079
Domain Number 1 Region: 1759-1860
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000285
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3703.m00079
Sequence length 1865
Comment hypothetical protein
Sequence
MSKHFTNLNSSGANANPLTIATGSQIAVSQISPVSPYQSSHYYIPNSYDSIQNDGFSNKS
STISTVKEAPFYQPCQISVESEYNKVSQVIDNCFANDPVQKESLLNSLKTPNSLKNNNLS
ITQPKQVLQVSKKNNIVTPLDLAEKNLGNADYGKQFQTPVGQNKIQSQEQTIDLSTFQDS
QKYNNGYKDSNQQLKRHSTSSNAEEINYSQAIPFDHDFAGNQISSNRSTQNQQLNQDMYA
PQQNSNLDLQLQFECIKQNLEIQIQMLENRLLEVDLVRQKYFKMMIEDLKREKNREIFFI
QSLIKQNNWDQSKNMKGIDSIKRKITDIGIEMNDLKDLKNVHTKYKPSIYYDPNRASKIL
NLRRSNSASQLLSYVRNKPLDLPEIIEIENQSQQEREILPASRLPFYQSKHFTDFKQADN
PQEHKKYQNNDFYCQPSNSNITNQYLTPNKQSQVGYQTQQAEDQQNIYSYQTPTNLIIEN
NNSYYPQDLNAISSNKSQSSTTPYSMYADKQNDQKNWYNDNHKQDKEINLDQYKKVVPSY
NRHQRNQSLYTQKSPYYENKNNQFTIEMCHNKINECQAQKTNSQQQIPSVQVQEILNNKD
SQLDYKLNPPFNLEGKFTQPLPQNTSNDNNNNKIQADLEREQSQDEEDMIKRTPQNNFSN
PNYPHDEKLEESLKSNRPWANIMNSQKKKLTESNHSSRYSACNEDSQKDQELESNQFNSI
ANIQQNYQEPKFYHCRKFNSDQKNNKSDINSVFLSNKKQDDHKDFTQNMPEIADLDENKT
NFQYFYSQIQPEQNEQMFYHQKQNPEQLVKDYQIHNKHFENIIQSVKLNSPDGYQQGYFP
SERVETARFENLNDIQSRKGLHSQTEFNFQSAQSIDRQHDNKHKSNQNQEIIQNQSYENL
SIKQNTPTQSNKDFDSFAHENSFQNIQNQNNSLNNSKTFKDANIQAMNNSRDKSKCQTDQ
NELLQVQGENILFNYKCNPQPIQDLNSMISSQQKQDTQSFYISEQDPSMLFSTNNNNYLA
QYQIDQSHTYVNQGESFFSEKDQIRVSQKKQYLQNQSRGQYDFENQSVRQENLPIIEEQL
QNSDESQRSSQIHNNQQLQYFQDEAQNVQETKNNNLQIDNMYQQSINHQMNKSNNQSYEN
GTQQKVGVPIIDSRFEQKNNRIILNQYSDSDVENQYKNNASNQRGSQSNLAVSKQSVQNM
ENINKIIERHITIQSSTGSEIIKNAQQQNQIEKKFQDNRQLYQENQKSQNESSDKILTNT
KTKEQTLNEQNEFQDHIQAQYIESRNITQQTQDQFFVGNVKARSFLTDREFREYLTDKSG
THSNKKGNEQSDNLTNSQRSEESKFAKCKLIYSFNNQCLKLTFDSSLLYSLDEEQTIIDE
IPVCQINIDQLDFINLPQNKIYLKLSYKNQPSLNNKIILMQFGSATENCDYFTQKNHLEN
LKNKIQLIYQLKDDPEDLNSKLIINSQPVIQNYSQNALSSDVDIQNQRNGEGEQEESKSE
IKYELDKEYIPSSKRLTQGNYNIQQQQQQNDIFSSVNNQESQSNNQQDYEKQKLRTPQFQ
EINCESQQNKYDNTLQSPIPFNQKDQNSFEQEKNITKENEQRQKQKCLAEIMEENSEQFQ
QKSASYCQNQKEKQEVQIFSGFSNHDSVLKQNVVDLSQRFFLNNQKQFSTIKRENEDEEV
GDVSQDIENNIRQFNELNPNIEDYQEDQAEFSMSQIKDQKLKQKLLQYNKYKMAQYSQRT
DEEENLLKILKNFDEKLFIMKKYGQNSTKGQLRRIFFSSDFRFFCWKGDKSPELKRSFPI
NKFQPYIIHGRNTENFKRFKTSNQMEKDLSFSLVLDDRTIDLQAKTIEEKEEFIKGLQII
FNCIL
Download sequence
Identical sequences 3703.m00079 5911.XP_001022996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]