SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3720.m00070 from Tetrahymena thermophila SB210 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3720.m00070
Domain Number 1 Region: 586-702
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000761
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3720.m00070
Sequence length 729
Comment PH domain containing protein
Sequence
MNQVDILSAQGQSGHLFNQSLHQYHNKFNDPENNLKNDQKSSNEECEYEINNKNLNPENG
SDQNQEISCNENIQTIIQQQIKELKSMAIILKQKFYEEKKSDFDQSIIEYTQQQKKLYQE
KSEFEKGNIQKTFSFNNQNQKPQTNILSPRQEAQAIQEEGSQYKQEEQQITLPQQIENLN
QNATQPQIQQQKIQQPSQNSNKSNSESQVSDSESEEDSNSEDLQIEKLNSQNLLLENTNK
RLVERINQLNSTIEKQMEEQNQIKQRNEQITSLLYTCSFAQQQIYQVVQSAQDVSVCQGL
VTIQGNKIIIYDEINSELKTSPDKIFQIYELVSIEYQKITIKMNFEKSLTLKIQFKHRDD
LKQFDSILYIQRMKKVLYPKKPFFYHPQLPKADGVQARVFEHIENRSFSPIRTQTYNPEL
NTSISDQQNNINILQSAYFRSSNEAQDEEKQKPITQSQQLNPTTQGIKKETISNENFQIP
KSPQKINSALKMYQQRRSLRQESGKELLSFQPNKINSDQQFNNISSQKINDIRNFSKEGT
QETTEINKNQSNLQNLSILNDSNLNKSIVSTKQKKNKKQIISDERIYEEAMDYLKKGENM
IKYSKNGILGPKEKTIKIRNLELIWFPVTKDEKKAKSIKLEDIISINIGRDSPGFLRLKK
QENNQKCEDNFFYIRCKKDRRLELQAIDQNQRNTFIKHLQRVLLNKCKETYKEKPLFEDD
VNESQDFNE
Download sequence
Identical sequences 5911.XP_001010196 3720.m00070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]