SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_108200 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_108200
Domain Number 1 Region: 20-58
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000497
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Smp_108200
Sequence length 60
Comment ||33664.t000001, 33664.m000007|hypothetical protein|Schistosoma mansoni|chr unknown03|||Auto
Sequence
VCGLQISNQFSIKNRVIASPPLSIAAAPGLILAHGHVATHLKNTPADVFVSSDGGYTWLK
Download sequence
Identical sequences Smp_108200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]