SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_134900 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Smp_134900
Domain Number - Region: 3-46
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000942
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Smp_134900
Sequence length 420
Comment ||29087.t000032, 29087.m001035|Hypothetical protein, putative|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MALDGPHHYQIANRGGLIVAVPAETLWPDVLRFSTDEGKCWHTIPLRTGQWSINESNRYQ
VNNNEDDSMKSQTHHDDVLDDSEESLDKIKSTSVKVTDIPSPSEEQRIVFDKNTIPTTTG
SSLDAVPRTTTTITTITTTVNASTVNNISNDTNNISPINQLHADSHQQFQTNDDKWSSAS
STSSQRTDEIVVFTGLVTEPGGRAMAAAVYGYGTATQRWRVAVVDFRTNGMIKRKCSVGD
GVTVATNPLRDTLFMGNDRLYHQVGGLFTTASAALIPIGQTKSVAKGLTEFTIGEVGGFI
GGQASYHGTKLLGCSEQDAQRATLVGNILGGLAASSAARRFSLNEPIAAKVTKPTYSLQQ
LMKNLENSRFARQSSRLIKSQQEQCNVILRRTSTKGRGRIFSNNHIFDDGNDDDKNKKIE
Download sequence
Identical sequences Smp_134900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]