SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_137250 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Smp_137250
Domain Number - Region: 52-87
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0392
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_137250
Sequence length 118
Comment ||29098.t000070, 29098.m01240|hypothetical protein|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MDALSSFDEKPRNFMKHCYTNFYHKLRKNVGPSVEQIIAYTNPLGILFGLRSNGGGAVMS
KDLGNTWISVNSFVYQKTLNTSTEIITASVMPWISLSGSIDNTLFESFCKMRVAQQWN
Download sequence
Identical sequences Smp_137250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]