SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_106060 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_106060
Domain Number 1 Region: 182-464
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.5e-74
Family Mitochondrial carrier 0.0000605
Further Details:      
 
Domain Number 2 Region: 2-157
Classification Level Classification E-value
Superfamily EF-hand 1.46e-29
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_106060
Sequence length 473
Comment ||31050.t000047, 31050.m000986|mitochondrial carrier protein-related|Schistosoma mansoni|chr unknown02|||Auto
Sequence
MSDLSDTDRERIGKLFSDLDIDKDGRISVAELSRVIKGSKDETDTKSKTAKKIMTKGDTD
KDETLTFQEFISYIHDTETHLKLAFKEIDQNSDDRIDASEIQSAMKKLGANVSEADAQKL
LKRIDKDGSLDIDYKEWRDFLLFSGTSKIDEIFRYWRHASAIDIGENMCVPDDFTEEEKK
SGDAWKTLVSGGIAGCISRTVTAPLDRIKLTWQALGSKASEVGLLGTVNKMVKEGGVTAL
WRGNGVNCLKIAPESAIKFQAYEVYKCWLNESFGSNPDGSLQLHTKFLAGSLAGATSQSI
IYPMEVLKTRMCLRKSGQYSSIFDCARKLYHSNGITIFYRGYVPNILGILPYAGIELAMF
ETFKQSYSKAFLSKDEKSLNIPPPVYVSVVAGALSSLCGQLGTYPLALVRTKLQAQSSSE
KTGLLKIVKNIVEHEGVPGLFRGLGPNILKVLPAVSVSYACYDQIKAFLHVSK
Download sequence
Identical sequences G4VEN7
Smp_106060 XP_018651007.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]