SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_122030 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_122030
Domain Number 1 Region: 5-218
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.24e-44
Family BAR domain 0.00011
Further Details:      
 
Domain Number 2 Region: 268-322
Classification Level Classification E-value
Superfamily SH3-domain 1.18e-20
Family SH3-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_122030
Sequence length 327
Comment ||48072.m000334, 48072.t000015|sh3-containing grb2-like protein 1 (endophilin II)|Schistosoma mansoni|chr unknown10|||Auto
Sequence
MDKGPDYKQLTQLMDSYKAFYEDIQKRVIDCLEPNPNARKRAWANAAVNKIQGTTSNDSY
PHAEKILSDCFLEYGRQLSQQSDLSLALTQCGEAYNKIVESKNQSVDETKSGYLKLISEK
LHRDIRKISALRKKVENKRLTLAHRKNVLERTKAQPDQAFEESRIQYEDALAASTTAMSN
FLDTEVEQIKTLSNFVNAQLSFYQDAARILSDLHGGLEMRLLDARDHARRQTPYPISSNN
ALPDIPSLYHDSANFQMKPKYDDHSNRTPQCVALYDFNAESPFELSFCKGDSINLIEQID
DNWYLGELNGQEGHFPTNFVHVTCPLP
Download sequence
Identical sequences G4VAV5
XP_018649408.1.29077 Smp_122030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]