SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_139410 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_139410
Domain Number 1 Region: 347-438
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.28e-32
Family Small-conductance potassium channel 0.0000339
Further Details:      
 
Domain Number 2 Region: 219-387
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-23
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Smp_139410
Sequence length 477
Comment ||29111.m000939|conserved hypothetical protein|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MFDVPSEKYTIGWHQQKHCLKYHSTNLEIPNQYNETISPSIETYPESTNQISLHVPKLLS
INKSLSNDCELSLRIRRVSMMLQSRQDMTAHSCNNQLNQSIDYGTSKLNTSGSSTNPLKK
NNHNDLIIEHINPIDDSPVMKKSRTSPEVFLCEEYTKDWRICVTKHRIIQIITELLICSI
HPFPVTNYINYKRNYLLSSNQLSDHFSPYLLLILPMLGRLYLALRALLLHSRMFNDAGSR
SIGAFNKVSFNLQFVLKTLMTLCPAKALLVFITTIWIIFSWTLRACELEQGDNHLSLLNS
AWLISVTFLSIGYGDIVPHTSCGRLIAVATGLMGSACTALLVAVFSKKLEMTKAEKHVLH
FMESSKLTKKVKHCAANVLRETWLLYKHAKLMPTFNSHRVRAHQRKFLQAIYRLRTMKVK
QRELQDKSNSLVDLAKLQTNVYERVADISLRQEDFQNQLTTIEDMLKSIQVQRKITA
Download sequence
Identical sequences G4VN82
XP_018653717.1.29077 Smp_139410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]