SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Smp_156150 from Schistosoma mansoni

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Smp_156150
Domain Number 1 Region: 990-1079
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.83e-33
Family Small-conductance potassium channel 0.0000333
Further Details:      
 
Domain Number 2 Region: 861-1031
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.49e-24
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Smp_156150
Sequence length 1120
Comment ||29232.m000448, 29232.t000022|calcium-activated potassium channel|Schistosoma mansoni|chr unknown01|||Auto
Sequence
MDEKVKELEDDEEEEEEKEEGRKEQTTENKSEYSSEIQKAPHSILDDYDLRGFKRFSYLF
HHQPSTETDSFEMFQSVSSTKFLENLDDFKHSTSGSWKSVISSFEDVNTTNNSNNHKNNH
HQTPEASSYSSKSMEAKSNIDNSSHTTMNAQLKQEPQMDDLQNVKEHLDDSFKSLSNTSK
DNSSRISYPDVTMHKTDSLDNVTRRFEVRKHSKSSLLSNNQFRRTKFLKQKYADPNNNHN
DDHDHDSTDGIPRSSSKLKRTATEHITNRYKYHDRTESSSIHHPNDNIPVNPIMIRRKST
IHCLYPRHYSDAMKQDECLNSQTMIYEDINKNDKYSMMGMVNPNSSHSNNIPEFDTHLNE
YRLSEDLKSSFEKEDEMKADNLLEREAHIGALALAWASGTHKSKKSPYDKYSLNRETSDR
VPVKLRQHNNNNNHNYNHHHSRSTVISPDNFRFNNYTTNNNMSSKNRMTLSTLRELSTSI
FTPSKRNLITSSIHHQNATHRQKACYPIDETDRLHHDEKNIPITTTTTTTQNNNSSISSS
HKNKTDHHLIPQSIKHAIIRNTAKIAISPILHTNEENDNDEHLHTFKPSNEHSCDSIESD
QLEQFNRKDDHLHESHPTEEPPPYRQQHQQSEELRKLVDNGSQLILHSQKSSLQSEQLHD
INGIFETNDNDETNRPIGIRAKIRRNAEDLRSLYGTSGPLGSVQPQMNYRSSSRGIGWRL
HWRKIFNERRRKLADYSLFFAVMGILLMVFELEMIMAKVYLRTSIYSILIKSLISASTLI
LVGLTLVYHAVDVQLFCINNCIEDWRIAMNCRKISLTLIEVFICLIHPPPILSNYNIYSY
RNSYYTLSTLGKLIFSVPMFLRLYLIFRVLLLHSTMFTDAGSRSIGALNRVKINVRFVLK
TLATICPGTMLLIFILSMWIVTSWIMRVCEREQNKEYEKLLNSMWLIAVTFLSIGYGDMV
PNTNCGRAISVLAGVMGSACTALVVAVVARKLELTRAEKHVHNFMQDNKFYKNLRHSAAN
VLRETWLFYKYTRLVKRVKPGRVRRHQRKFLTAISRLRKAKDNQRKLKEDANSMVDLAKS
YINQMSDTFTGIIETFGTCNNIATISLEDETTSSNMNVTT
Download sequence
Identical sequences G4LXV9
Smp_156150 XP_018646098.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]