SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000002546 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000002546
Domain Number 1 Region: 80-185
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-34
Family Second domain of FERM 0.00000714
Further Details:      
 
Domain Number 2 Region: 184-320
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-32
Family Third domain of FERM 0.0000811
Further Details:      
 
Domain Number 3 Region: 1-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-24
Family First domain of FERM 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000002546   Gene: ENSCSAVG00000001502   Transcript: ENSCSAVT00000002587
Sequence length 328
Comment pep:novel reftig:CSAV2.0:reftig_51:132252:141471:-1 gene:ENSCSAVG00000001502 transcript:ENSCSAVT00000002587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQIYLLNGQEFRCEVDKQANGSALLKQIYDLLNILESDYFGLYFMDQTDQKYWLEPNKSI
KKQIKNGPWSFFFAVKFYPPDPAQLHEDITRYYMVLQLRDDIVGGRLPCSFVTHALLGSY
VVQSELGDFDRTEMRGNYVSEFSFAPNQTRELEEKVMELHKTHRRQTPAKAELNFLENAK
KLSLYGVDLHIAQDSDGIELSVGVSWNGIHVYRDGTLINRFAWPRVIKLSYIRSKFYITI
RPLNGNTLLNMIGFKMPNHRAAKKLWKSGVEHHAFFRLVKSEPQRRPKLIRVGSKFRYSG
RTQQETRKIVTENEKRPQPTVVRTHSKR
Download sequence
Identical sequences H2YB48
ENSCSAVP00000002546 ENSCSAVP00000002546 51511.ENSCSAVP00000002546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]