SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000003227 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000003227
Domain Number 1 Region: 257-524
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-52
Family Nuclear receptor ligand-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 154-240
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.97e-26
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000003227   Gene: ENSCSAVG00000001918   Transcript: ENSCSAVT00000003276
Sequence length 531
Comment pep:novel reftig:CSAV2.0:reftig_251:199938:213377:-1 gene:ENSCSAVG00000001918 transcript:ENSCSAVT00000003276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMTAGLNVEPHFKAFSTNPSETACDMSYRFLPSGSPLFRHSSSDAGTDLSNHDSGQSNR
KPDLKRKSEDMVQDPASMPFHPAARGGFSLNSFAFDALQNIQLGQHHQNSDIVPNSLLKI
AESHRRSPDSKPSTTSVGITQNQSFFDNDEDDSWKVCGVCNDKATGYHFNALTCEGCKGF
FRQATAAFYTFTCTYNNQCSITKSNRRQCQACRLRKCIQIGMKRECIMSPDEIKMKKTLV
LTNRIKRATMQWVPMEISTEQKMLLDTICSAFIQSNNMPENDVIRGGETVRRDAERSSPC
SSPSSSNNSNFLELIKRLADDIAARTPSNMTNHAHVLHFTDIMEFSIKEIIKFCKKIPTF
MDLDLKDQIALLKAGCTEILFIKANYTYDIEKKALTLGPDILYTRDSFLQGGMSEDYTDY
YLKFHEDLSSLQLDDVEMSALSAVALFSADRSDLVDHLRVGAQQEVLALALQAYSETSWK
IRNRFAIIMSFLPRLRTLNSLCTNAFSQVKKQYGNEIGPLVQEVQPTVETP
Download sequence
Identical sequences H2YD29
51511.ENSCSAVP00000003227 ENSCSAVP00000003227 ENSCSAVP00000003227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]