SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000003417 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000003417
Domain Number 1 Region: 221-510
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-58
Family Nuclear receptor ligand-binding domain 0.000000643
Further Details:      
 
Domain Number 2 Region: 172-248
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.2e-25
Family Nuclear receptor 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000003417   Gene: ENSCSAVG00000002034   Transcript: ENSCSAVT00000003469
Sequence length 511
Comment pep:novel reftig:CSAV2.0:reftig_304:73073:78137:1 gene:ENSCSAVG00000002034 transcript:ENSCSAVT00000003469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSLLNSDDTLSSMLFIKQEPGSPLESSVNFNSSFNSSLSSSPDSLCSDGGAYSPPSMVH
LGFPSLFPSMLSPDDMPSSVISRLNCNFNNNRATSSGDEDVFDDISACMASSDSSGDAMM
GLMPSSLSCYKSDTDSAQAFALPTSLVLKTSTASESNAAATPLSVNSSPPKRLCLVCGDI
ASGYHYGVASCEACKAFFKRTIQGSIDYTCPAANDCEITKRRRKSCQSCRFSKCLRVGML
REGVRLDRVRGGRQKYKRKIDSNDMTYLVAVPPVESANNMLSTNKILSHLLMAEPDKLYA
APLHNERTEISILNVLCDIADRELVVIIGWAKHIPGFSVLSLADQMGLLQSAWMEVLVLG
IVFRSLNRDGDLVFAEDFSMDAESSSEVGMVELHHYLSHLQRRLKQLNFKKEEFVLMKAM
VLVNCDSPHVENHQTLQQLQETLLQTLSETAQSSSTDPLSGFASQRCGQLLLTLPLLRLV
AAKAVHFFNSVRQSGKVVLNKLFLEMLDAKL
Download sequence
Identical sequences H2YDL9
ENSCSAVP00000003417 ENSCSAVP00000003417 51511.ENSCSAVP00000003417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]