SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000004251 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000004251
Domain Number 1 Region: 199-329
Classification Level Classification E-value
Superfamily PH domain-like 4e-27
Family Third domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 6-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-19
Family First domain of FERM 0.0054
Further Details:      
 
Domain Number 3 Region: 85-200
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000128
Family Second domain of FERM 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000004251   Gene: ENSCSAVG00000002511   Transcript: ENSCSAVT00000004314
Sequence length 487
Comment pep:novel reftig:CSAV2.0:reftig_51:655187:674327:1 gene:ENSCSAVG00000002511 transcript:ENSCSAVT00000004314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADARKCCIYLPNERKLELNVQPKLLGRDLLDIVADHFKLREKEYFGIAYKSEGGHYSWL
QNDKRVLDQYVLKKSTSRIDLLFAVKFFVESVKLLKYVTTTELYFLHVKSLVYKGQLEVD
NDTAFRLAAYALQVSKMTYDDTALSQLKKAPVLPNKALRDLPTEKWYVLPVLELYKGLKG
CTKGKAIISYLTTIEALPAYGIHYYKVKDKSGVTWWIGLSHKGILQFEIQDKANPVKTFL
WRQLENLYFREKKFSIEVTEKHQQTTKEHLYVEAKRKLTGDLKIHAWYGTPSLIKSIWIM
AIDQHHFYLERKQNKTKLHTVNSITNLSNDLTANANSLINKIILPRDDCCTCTTLKYTFR
ASGSKDETPEMRAAKRQMLDALKTHKTDLEDRLYDKVQELKQLCLREADLIGKLPQEYIR
YMDAGEKQPKIKKRIVTAASSSSSGFSSEAADASDELTQLETEFELLTQIASAAKKLASD
PNTRGRT
Download sequence
Identical sequences H2YG03
ENSCSAVP00000004251 51511.ENSCSAVP00000004251 ENSCSAVP00000004251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]