SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000005564 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000005564
Domain Number 1 Region: 203-291
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.62e-21
Family ets domain 0.00095
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000005564
Domain Number - Region: 71-193
Classification Level Classification E-value
Superfamily ssDNA viruses 0.0555
Family Microviridae-like VP 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000005564   Gene: ENSCSAVG00000003321   Transcript: ENSCSAVT00000005638
Sequence length 296
Comment pep:novel reftig:CSAV2.0:reftig_46:165473:168208:1 gene:ENSCSAVG00000003321 transcript:ENSCSAVT00000005638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENPNCSNECTSQNSQQSYFEVPAPRWDDDGFGSLETFQSVPGICTTMQSIEVTQDGQQD
IIMSTVYGVEEMHDLSYNQYGMQLFTEPLSPTQHQTSDLLNVANTVCSTMDQYPVQFMSN
PQEVMMTAVDPILSNAYGQTTTQTTTNYTNLGLPVITINQADLTSNEEISSDYFSDTISE
NSIQVSDDEFPSDDSDLPPSPMHPSLLQTGNQRRKRRQPILSEFLYSALENPDEYSNKIR
WVDRSKGTFEFISEKKEELSEEWGTKKKNHKKMTYQKLSRALRLYIRKDRVLYKEK
Download sequence
Identical sequences H2YJR5
ENSCSAVP00000005564 ENSCSAVP00000005564 51511.ENSCSAVP00000005564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]