SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000007180 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000007180
Domain Number 1 Region: 97-208
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-19
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 2 Region: 13-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-17
Family First domain of FERM 0.0038
Further Details:      
 
Domain Number 3 Region: 402-461
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000667
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Domain Number 4 Region: 241-332
Classification Level Classification E-value
Superfamily PH domain-like 0.00000738
Family Third domain of FERM 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000007180   Gene: ENSCSAVG00000004291   Transcript: ENSCSAVT00000007273
Sequence length 513
Comment pep:known reftig:CSAV2.0:reftig_1:726106:730381:1 gene:ENSCSAVG00000004291 transcript:ENSCSAVT00000007273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPLDTFKWQSGTVVCLVSKPDSVVIEVEVDRNAIGQEILDKVCTSIGTIEKDYFGLQF
YGPKREPLWLNLRNRITNKISGQSPFRLRLRAKYFVEPHYLIQETTRYLFYLQLKQDLLD
GRLEIPIEKFSTVLAFAAQAELGDLTLDVPTAEVFEAYAALCTSDEENQALYSGELIKVH
SSHLLLRGMTKSSAIAKFLAEVAALPTYGTESYHLKLETSSPPSVSTTRSANSPVVNRRY
QIGVILRIGPNGIEVLGEDNQEIKIIPFKAVQLATHSGKMLDIHVYQDDSSITTINFRTV
SESHSNALYRIITEMLAFYTWDTVHSSVMHQHSLDFKGHFLALFRPNDSDMGKQYVFDIQ
RTSREVYDNARRTLYRKQQKLQSAQNQIAASSNPESSDMISEELEVLQERLTLISDALTC
RVCLDNEIDSAFIPCGHQVCCKFCAERCQQCPVCRQQIQEALTVFLPVTKDFVNNGVSNP
EPCDVQTCDVEPCDVVEPTRTAHCANHEMQIAV
Download sequence
Identical sequences H2YPC2
ENSCSAVP00000007180 ENSCSAVP00000007180 51511.ENSCSAVP00000007180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]