SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008076 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008076
Domain Number 1 Region: 40-783
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-255
Family Motor proteins 0.000000000238
Further Details:      
 
Domain Number 2 Region: 1974-2090
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-22
Family Second domain of FERM 0.0034
Further Details:      
 
Domain Number 3 Region: 2091-2181
Classification Level Classification E-value
Superfamily PH domain-like 9.96e-21
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 4 Region: 1217-1320
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.62e-17
Family First domain of FERM 0.023
Further Details:      
 
Domain Number 5 Region: 1866-1980
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000196
Family First domain of FERM 0.058
Further Details:      
 
Domain Number 6 Region: 1312-1406
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000017
Family Second domain of FERM 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000008076
Domain Number - Region: 1588-1635
Classification Level Classification E-value
Superfamily SH3-domain 0.000317
Family SH3-domain 0.0053
Further Details:      
 
Domain Number - Region: 776-869
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0398
Family Motor proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008076   Gene: ENSCSAVG00000004814   Transcript: ENSCSAVT00000008184
Sequence length 2193
Comment pep:novel reftig:CSAV2.0:reftig_133:544725:590808:1 gene:ENSCSAVG00000004814 transcript:ENSCSAVT00000008184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FELFFQGDHIWLLDKATQNGTKVPLGAVVKMSDSGQVKVVDDEGNEHWLKSPLTNIKVMH
PTSVEGVEDMIRLGDLNEAGILRNLLIRYNEDHIYTFTGSILVAVNPYQELPLYDIDAIR
KYTKRKLGEPPHIFAIADNAYNNMLRSKQDQCVIVSGESGAGKTESTKLVLQYLAAISGQ
HSWIEQQILEANPILEAFGNAKTIRNDNSSRFGKFIDIRFNQDGIIQSAKIDQYLLEKSR
LVHQTTDERNYHVFYCMLAGMAANKKQELGLGKPSEYVNLTQGSCLQCAGRNDKEEYGDI
VRGMKVCSVAILIIYEIFRLLAGILHTGNFQFRETMTDNLDSVELIHNSGVKRTAQLLGV
NEQSLMRALTQRTIITREDTVTSPMNLEQSNDVKDAFIKGIYGRMFVWIVDKINSAIFKD
SKTKKKHWNTIGLLDIFGFENFGNNSFEQLCINFANENLQQFFVRHVFKLEQEEYNKEAI
EWKHITFKDNQDVLDMIAVKPMNILALISEEAMFPRVRNLIRQHGKNILFKNPKNQFDET
FGIEHFAGAVRYSCAGFLERNRDTFHRDLMNLIQGSKNKFLKLLFYQDSGSKSNSHRRNH
TLCEQFKKSLDSLMRTLSACQPFFVRCIKPNETKSAHNFDRELVARQLRYSGMMETIRIR
RAGYPIRYSFSEFIDRYRMTVRGIRPSKLENDHIAGCKRIISEALGENSDCQVGKTKVFL
KDAHDARLEIARDAAISRWVIVIQRAVRGWYCRHRYLTQRKSAIRIQSAWRKYTVQKQYF
VIKNGYSRLQALWRARRLAFRYNFARKRIIRFQVQCRGFLARKNVRHKLWAIIKIQSCIR
GGGCMCVIYISLAGYIARQEYRKLKNLRKVKKLPRGQQKVQNNKIKHYECMLYISKDVKM
LKKKGLSYGRSSGYLMSEKRRKMSLAIDHTEMVDKIFGYLDLEDGNGEAADTSIPHMEEK
EDISEYKFSKFAATYFQANATNAHTKRQLKTPLLHHENEGDKMASLAVWITILRFMGDLP
EPVKRDNAPKRDNVPVMNKIHDTLGRSYAKNAKQIEEMHSTESRRRKSSSKQNRLISMTL
KKKSKLTGEVANKLRSGEDWIDVINSMVMDRPTTNLEKLHFIIGNGILRPNIRNEIYCQI
CKQLTNNVFKSSHSRGWILLSLCVGCFAPNEDFVKYLQNFIRGGPLNYAPYCEQRLLRTF
ANGPRSQPPSWLELQATKSRKMIMLPITFMDGATNTFLADSATTAKELCDVLAKKIGLTD
QFGFSLYIALFDKVSSLGSSGDHVMDAISQCEQYAKEQGAQEKHAQWRLFYRKEIFTPWH
DPCIDKVSTTLIYQQIVRGVKFNEYRCNTDLELAQLASKQYYVEHGASIQTTSLAPLISS
YLPDRIVTSQKPLSHWSSMIMKQHKEAIYTRERWEPLRVREDVVKQARFSWPMMFSRFYE
AYRLSGLPLPTNEVLIAVNWTGVFFLDDQEQVLLELPFAEMTGITANKGFLSEMTLNINN
FFDLQSVLSLEILKPSECIKTEAVSEKMKAATITVTTVRGDALTMTSSSSDDVCELVNLF
IDGLKERSRYVVTLNTNPNKVMDESSILKFKKGDLLVLNQPAGADFNSSAWRPGRNERTG
VSGDFPTDCVYVIPTLVKPLDDLVNMFTMSPGELAQHGRRVSKVGDNDFDLDEKPYTLEE
YADEFFRAPIPQTINRAPPSRRGKEKLYAMSREPIKQPLLKKLEHNHDMTQEAITPNLNY
FDLNSFAPIMKYMGDYPSKKQRHGNEQTDQIFEAPLKHEQLRDEVFCQIMKQLTNNKQSY
SEERGWELMWLATGVFAPSNQLMPHLHKFLGTRRENPMANDCYHRYKRPTTHGHRKYPPH
LVEVEAIQHKTTQIFHKVYFPDDTDEARIKFFFQAFEVESSTRAKDFCQNIANRLRLKSA
DGFSLFVKIADKVISVPENDFFFDFVRHLTDWLKKARPTKDGSTPTLTYQVFFMKKLWAT
TKPGKDPNADNIFHYFQEKPKYLRGYHKCSKEDAYELAALIYRVQFGDDKSQFPNIPRML
KELAPLFLLRQASPDDWKRNIVQHYNKSTIRTKDEAKLAFLNIIFKWKTFGSAFFEVRQT
TEPSFPENLIIAINKHGVSLIDPKTKTVLVTYHFAKISNWSSGNSYFHMTIGNLVKGNKL
LCETSLGYKMDDLLTSYISLMLNMVQKNSKRKL
Download sequence
Identical sequences H2YRW6
51511.ENSCSAVP00000008076 ENSCSAVP00000008076 ENSCSAVP00000008076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]