SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008226 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008226
Domain Number 1 Region: 685-935
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-48
Family Nuclear receptor ligand-binding domain 0.000000627
Further Details:      
 
Domain Number 2 Region: 612-690
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-27
Family Nuclear receptor 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008226   Gene: ENSCSAVG00000004898   Transcript: ENSCSAVT00000008334
Sequence length 953
Comment pep:novel reftig:CSAV2.0:reftig_140:171825:175511:1 gene:ENSCSAVG00000004898 transcript:ENSCSAVT00000008334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCSLIMPISCFGSGASLTATQDPSIVAHPPRNNIYKSEYSSEDNFPLFEQQPSGFMTSPQ
YTAPLGTTPPLTRSPTNQEDSLPQTETMATIPATGFLTPTQSWSNEDLNESYQNHNLSLP
TSYRGAEPFSGSPSFAMSTYRELSPHATSPGRSNEQGEARMSTTPPSNHFNNSYKNNNEN
NGLLHILPNHLSSGGENMADASMFGNRHASSPKFTTEAPDFYCAPDSSFQGSPASTSKDY
KYSRKLNSTIDPAAYPTTYPTTSLAGNARQRQYRHHSYTGCPRRPDVPSPAPSSPDDIFI
PNNDNHMSYFSTESPRPSFSEQEDINYTSFPNNVAVTETKPFNITVLKKSPSLGHERGSI
KTDYSQNQSLDINTSFVNYPSTIFQSPNHTIPAAQYDQLYCDAATKLPAFDESLHSQRIG
KQRFTSMLNSPLEPNNAHQDVNRVSSAQRLQNSPTDLSVNPPRMGTQNALYNPEHSPFGD
DHLRGERKISVPSTSSELSSLLAPYRERQRYTTPNVQEHTIGHTACTLPNHTLPIPLSGT
ATKELNAESVFASGLAYNGQMYLAIPNSSGGHFHPFRSQYSGTDRHHPYQSSQLLTSASM
APSTSSRASSEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKKSTYVCLANRNCPVDK
RRRNRCQFCRFEKCLAVGMVKEVVRTDHLKGRRGRLPSKPKGPKDPVAPPSPPVSFITSL
VRAHVDTNPAISTTDTSKYRPPGLGHLVAPQRGPDEANNFYELLSSCQGVIRQFADKVPG
FSDLCHEDQNNLVENSFLEIFVLRLAYRSEVQEGKLIFCNGLALHKDQLYGIFGDWMDSI
FSFACSLSDMNVDISSFSCLLGLLLFREPRGLIDPKKAEEMLALSIESLKDHVTKSSVTS
DRPNLFAKLLGILPELNALGKMGSRKIHRHHIESPEVLVPQCLQRYLVSNNHL
Download sequence
Identical sequences H2YSB6
ENSCSAVP00000008226 51511.ENSCSAVP00000008226 ENSCSAVP00000008226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]