SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008329 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008329
Domain Number 1 Region: 41-175
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-35
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008329   Gene: ENSCSAVG00000004952   Transcript: ENSCSAVT00000008437
Sequence length 175
Comment pep:known reftig:CSAV2.0:reftig_26:387150:388717:-1 gene:ENSCSAVG00000004952 transcript:ENSCSAVT00000008437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSKVCPTTASLSVVTFSRCPRRRTDWGMEEAALFDAVTTPSLEWVAVKCMEWSFGDTQ
WNRNMEKRLPDEIAVSLSMNHENIIRVHGVAVWPKSLGLVLDYIPGGQLEELLGNWSIDP
LPWTVRLRISYETANGLSYLHNFSKEKRIVHGDIKPENILLTSDLHAKIADFGGA
Download sequence
Identical sequences H2YSL9
51511.ENSCSAVP00000008329 ENSCSAVP00000008329 ENSCSAVP00000008329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]