SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008417 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008417
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-28
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 2 Region: 172-284
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000108
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 
Domain Number 3 Region: 599-712
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000297
Family Second domain of FERM 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000008417
Domain Number - Region: 482-599
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000145
Family First domain of FERM 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008417   Gene: ENSCSAVG00000004999   Transcript: ENSCSAVT00000008526
Sequence length 777
Comment pep:novel reftig:CSAV2.0:reftig_194:168985:178011:1 gene:ENSCSAVG00000004999 transcript:ENSCSAVT00000008526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMASSEGDYAIPPDALSLHPSLDPSDSSEPEHKLFKTSPDPGPSAPVKPPVDTSQVAHNG
SKAGYLSKLGGRVRAWKKRWFVLQHDTLVYYKSPNDVGKKPQGQVPLSALESGEVAKVTR
DYQTNCTFHILLGKRTFYFIAESQAVADNWVQAIADVINGSQPPKYKHDVTDGWLKRTIG
GNSCRVWARLNGGAIECYEDKLSKTTQMLLSLRGCGIEDVQLKVNPGHNRPNSPPPAFEH
VIVIRPINDGEPDVFLSFDSEVEKATWFRALKTSLRTSSDPTATTEVERLLVRLVQSEPK
QGSSQQAHTSIWRNPVLCYNKQGPTRPLTTLSSEALQTEAMKIAKSIQLFTNVALDVASA
DYHVTLVQRIAHSCLTHLELRNELYAQLIKVTNRRDSEVGDPSYLQAWKLFSLILPLFLP
GSSILWCLAAHFKRHSSTKNEAGQYVIYCQRTLERTKALGERMVSPSKTECLSVLLKNPY
HHSLPFSVPVHFADTSYQVVSFDGSTTASEFATRVCTQMAVRNQSMAGFALYVDDPDVTL
QIDHCIEASVKICDVISIWETVARLGAVTTKGIPPTPQDSATDTNRQTARFTFKRRLTFQ
SYARLESDKEKKLIAYQLADNLAHDVIPMTRELSIEATPLAAKFYLGDQSRTAPGSLDHV
MKMFHPHRFQEGGSKHQHKLIRERINDRWVALEGTTPLECTKIFLNVMRKYPLCGAALFL
AKVETSSKQKGEVVWLAVTEGAFHVLNYKSMEVKEIYRLADVVTFGGCQDNLMLVID
Download sequence
Identical sequences H2YSV7
51511.ENSCSAVP00000008417 ENSCSAVP00000008417 ENSCSAVP00000008417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]