SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008663 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008663
Domain Number 1 Region: 420-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-76
Family Protein kinases, catalytic subunit 0.00000000913
Further Details:      
 
Domain Number 2 Region: 853-987
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.88e-37
Family FAT domain of focal adhesion kinase 0.000027
Further Details:      
 
Domain Number 3 Region: 102-223
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-36
Family Second domain of FERM 0.0000288
Further Details:      
 
Domain Number 4 Region: 224-344
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-28
Family Third domain of FERM 0.0000245
Further Details:      
 
Domain Number 5 Region: 8-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-22
Family First domain of FERM 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008663   Gene: ENSCSAVG00000005150   Transcript: ENSCSAVT00000008773
Sequence length 1001
Comment pep:known reftig:CSAV2.0:reftig_79:684784:736133:1 gene:ENSCSAVG00000005150 transcript:ENSCSAVT00000008773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSVATLEKSLIKIHQVNNATSTVKYVETIDIKGIIRAVTHRIHPDGLHFEDCFGLRLRHI
KSGDIFWLHFSQTMTEVKEKYEIIHPIEECKYELRVRYIPRSIQDMLDRDRSTFNYYHNQ
VFSDYLEAVAEKVDHETAIKLGCLEIRRYFKDMPSTVFEKKSNFELLEREVGLRKFLPKS
VVDSMKTKDLRRIITREFKTVSHLTEEQCVFRFFEILKKITRFDQEIFRCALGTGWSVAV
ELVVGPEDGISYWTDKGSTPTILAEFSQVLSIQTDSSTDPSKKGVLLLKIHGANDVSTIQ
MFHCNLFIPLTITTTSLFVAENIADLIDGYCRLVNNTDQSLIVRAVKLFHNVANRSCFNC
MKLVQVISQHEIERSTPFVPVDPRPLPSITLNDTNNRKSFPCVTDTDDYAEITEDLYNVP
EHFDYEINRDNIHVVTTVGEGQFGDVHKGIYSTREIPEMPVAIKTCKFQGQDGMGMADRL
LEEAHTMRQFEHPHIVRLIGVCTEEPVWIVMEFCKYGEMRSYLQTNKHSLDTTMLITYTY
QLSQALCYLEQKKFVHRDVAARNILVAQPDCIKLGDFGLSRYMEDQNYYTASKGKLPIKW
MAPESINFRRFTTATDVWMFAVCCWEILMMGVKPFQGVKNNDVIGKIEAGERLAMPSNCR
PAMYSLMSRCWSYDPGFRPLFEEIQHELCMILDEATQQQEELRRLESGGLAAQWHSDEPP
PKEKLRQLQLEESKLEENLRLQQKQAEADKLWLQQEEQQLVMTMMYTEGNQLTFIYLPQN
PERTPTNGDVEQDPDHLYQSADEVRQRREASGEFEFSCNALKRQIRYATKNAMNAPPPPS
MPPAKPPRNLSTKDPTPTMKLDREGDTVYRDTMLVVKAVLQANQEIMGAKSEEIFVLVKN
IGKALKELCTSLDQEITSLPADYHREIDMAQKTTNKDLAQVINQMKLVKRFYSTTQVTDY
KKCMMAATQVLAMDAKNLLDVVDKARLSQFAGASQNGDEGS
Download sequence
Identical sequences H2YTK3
51511.ENSCSAVP00000008663 ENSCSAVP00000008663 ENSCSAVP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]