SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008791 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008791
Domain Number 1 Region: 29-188
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.88e-43
Family Protein kinases, catalytic subunit 0.000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008791   Gene: ENSCSAVG00000005212   Transcript: ENSCSAVT00000008904
Sequence length 189
Comment pep:novel reftig:CSAV2.0:reftig_2:453570:459969:-1 gene:ENSCSAVG00000005212 transcript:ENSCSAVT00000008904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDDVNGALEDDGKPIGESPDSRFIKFDIELGRGSFKTVYKGLDTDTGVAVAWCELQHHKL
SKNERLRFREEAEMLKGLQHPNIVRFYDSWDYQSPKGKKCIILVTELMTSGTLKTYLKRF
KSIKPKVLRSWCRQILKGLHFLHTRNPAIIHRDLKCDNIFITGPTGSVKVGDLGLATLKR
TSFAKSVIG
Download sequence
Identical sequences H2YTY1
51511.ENSCSAVP00000008791 ENSCSAVP00000008791 ENSCSAVP00000008791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]