SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009985 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009985
Domain Number 1 Region: 268-413
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-38
Family Third domain of FERM 0.00073
Further Details:      
 
Domain Number 2 Region: 179-270
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-31
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 112-176
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-18
Family First domain of FERM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009985   Gene: ENSCSAVG00000005885   Transcript: ENSCSAVT00000010107
Sequence length 417
Comment pep:novel reftig:CSAV2.0:reftig_226:101323:107571:-1 gene:ENSCSAVG00000005885 transcript:ENSCSAVT00000010107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLRRTFSRRGRRRPKPASSGRGIAESGIHIPAPDGKRGKAVISARVLLLDGTDVSVD
VPVICYIIIIIHFDQQGKNTKVIPDIKIKKQDFHYKFDLKYCFINDLNGDETKKALGEVL
YQQVISYHLDLVESDYFGLQFMDANQVPHWLDKTKRIIKQVKIGPPYTFHFRVKFYSSEP
NLLQEELTRYQFFLQLKQDILRGKLPCPFDVSVQLGAYALQSELGDYDPDVHNPYFISEF
RFVPDQTEQGQTPADAELNYLNIAKWREMYGVDMHNVKGKDGNDYSLGLTPTGVLVFEGE
QKIGLFFWPKIKRLDFKGKRLLLVVTEDDDRGVEQQHTFVFRLDHPKACKHLWKCAVEHH
AFFRLKSNVQQGQRQQMLRLGSKFRPSVRTEFEITRNRGPRKSLNFERRPSKRYSRR
Download sequence
Identical sequences H2YXC4
51511.ENSCSAVP00000009985 ENSCSAVP00000009985 ENSCSAVP00000009985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]