SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000010272 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000010272
Domain Number 1 Region: 154-374
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-49
Family Nuclear receptor ligand-binding domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 43-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-26
Family Nuclear receptor 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000010272   Gene: ENSCSAVG00000006056   Transcript: ENSCSAVT00000010397
Sequence length 599
Comment pep:known reftig:CSAV2.0:reftig_194:286101:290618:1 gene:ENSCSAVG00000006056 transcript:ENSCSAVT00000010397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACNQVFLNSRENSSRPKGNGSGMRDKRKTMKGYVPSYLDGNEVCVVCGDKATGYHYRCI
TCEGCKGFFRRTVQKGLHQAYQCKQDEKCKINKVSRNQCQLCRYKKCITTGMATDLVLNE
DKRLAKRRLIERNRQLRRHKDLGHVIETWKSNKLSEEEKHVINSVVQAHYDLGSYCDITG
VSSTASHNEHFSSALTNAVTRVVEFAKCLPFFSDQVSTDDQVTMLKGCCMEVIVLNAVTD
YDRQRGTLKLFSSVVVSRNQLRRTRFDNFADDLFRTAEEMAILQLTQTEISMMKAIIVFA
PDRPGVQQTGRIKNIQNFLLQALNHYLNDKRKHEYTVWSMLLLKLADVRRISTGFAASLM
HMKLNNPEELVILFSEHKTNDEPRYVKQDERFNHHCSKSNICKLAENKENELFTSPNSIP
PLSKESIRNFTYHEWLPFHCFNGTLPNYQGSYKLPRRELRPFPSHTTSIFPKIVNGPDFQ
SPYLQKNFRLKERSDKCADLKNTEYSESPAAQYTNRDSPSNPAKAGSKISTQTHVFKIFD
SNVTLLKTMSPNMHAEPNTSSSFKENKIPTHFHENITVPRRTTEGEPTDEAMNLSLNIN
Download sequence
Identical sequences H2YY61
ENSCSAVP00000010272 ENSCSAVP00000010272 51511.ENSCSAVP00000010272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]