SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000010645 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000010645
Domain Number 1 Region: 64-178
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-17
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000239
Family Second domain of FERM 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000010645   Gene: ENSCSAVG00000006261   Transcript: ENSCSAVT00000010775
Sequence length 499
Comment pep:novel reftig:CSAV2.0:reftig_166:268547:278864:1 gene:ENSCSAVG00000006261 transcript:ENSCSAVT00000010775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTFDPSLHSGRYFDPHEYVPTWFVKKWGVDYFWSHLPALHKEMVETTPFNVQAEYIKQA
SCIEDVPVHYYKLYKTKKESSPSVLLGIYHQGIRIHHLALQREEGAHLLDFEFPWNKVGR
LFFAAKRFEIYPEDLPASRRLTYYTGSHTRSKYLLRLLRETHSLYMSLTPFVQHLRKLDG
RTTKRKYRESYISGKNLEFDGSGSTDERMIGGAGELSPQSNDSKSVLLEKLYKSYTSSTS
RGSSHTSGIESDSKQRNEVDDDDDDVEDDDAAHMQDNAFVDDFDPIELDGPPSAGVICVT
EAHLEAPQHKSLSVSDLTEQLAGATVARESPSVSETTHSELTLKEEVFDFPEPTSHIDDV
TNDVITEPRPLPEVVTPGKVILNSDTLPLKIAHVRESSSEGIPQPGALKHSRSHDALSYI
SSSETSAFSHVTARKDVPPTQLRSSKTYYDDTHTIPRQHNLSSTDHSNQSSTARISRRSR
DGNDDKSRRHRHRKRSSRD
Download sequence
Identical sequences H2YZ83
ENSCSAVP00000010645 51511.ENSCSAVP00000010645 ENSCSAVP00000010645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]