SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000011864 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000011864
Domain Number 1 Region: 611-897
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000058
Further Details:      
 
Domain Number 2 Region: 114-217
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-32
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 215-338
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-31
Family Third domain of FERM 0.00023
Further Details:      
 
Domain Number 4 Region: 494-589
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-20
Family PDZ domain 0.00018
Further Details:      
 
Domain Number 5 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-20
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000011864   Gene: ENSCSAVG00000006963   Transcript: ENSCSAVT00000012002
Sequence length 907
Comment pep:novel reftig:CSAV2.0:reftig_19:950999:953873:1 gene:ENSCSAVG00000006963 transcript:ENSCSAVT00000012002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSRNLITGTGTYNVRATEAAREKKQSSVDISVMLLDHTEVVLKVNKRDRGQVLLDKVFQ
HLRVAEIKFFGLQFPNDVPDTMRWLDPSKSIRKQFKRGYPYILFFRVKFYATDLSTMKDE
FTRYQLFMQIKLDLLERRIKCSPSAAASIAALAVQSELGDYNSTEHKDDYVSEFRFIPNQ
TDDFKSDVARLHKMHRGLSPSQAEYQFIKQAQKLEMYGVEMHHAKDNDDEDLDVGVTSTG
MLLFQNGFKINEFRWSAIVKISFKRKQFYVQLRSGPKRESNHADPISSFHMDNYRACKRL
WKSCVDFHSFYRLDRCMKQEEEMARQEKHLFSFLTPSGKKGRGSEETVDDMAQHRRYLRS
RAGSTKSKENMSLPCNGDRRSEDKAPRRLSAPPSVSYGVGEARISDEKMLAMLQHQHSFI
QSTHSPSRNAPVVNSNYEANNNIEIPAPVKIPIQYHAADPALAASYRTLHLRPETAGEAD
ETAASEFAPTQNGIPNDLVIVRIQPDSEGRYGFNVNGGADQNLPVIVSKVAQGSPAAMCI
PPLNEGDQVLQINGRDISAHSHEQVVRFIRSTREHTGHLVLLVRPPEQPETEIPTEPVLD
YDGPGDEGALLERSMQWLEDMLDSGQILAMFDELYRKKPGSTMNDAKLPQNVTKNRYRDI
SPYDNTRVILNGIADTDYINANYVNMFVPGSNWTNRYIASQGPLPNTSFDFWEMIWEQQS
TLIVMLTTVVERGRPKCHQYWPDSETSVQFGPFIVESVSEEVTPSFAFRDFKLYKCKEDA
EMNGNEVSEARDIRQMQYIAWPDHGVPDDSSDFLDFVLRVRQNRVGMAIPTTVHCSAGIG
RTGVLITMETAMCLIEANQAVYPVEIARSMRDQRAMMIQTPSQFKFVCDAILRVYKEGLA
RPMYDDD
Download sequence
Identical sequences H2Z2Q2
ENSCSAVP00000011864 51511.ENSCSAVP00000011864 ENSCSAVP00000011864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]