SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012429 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012429
Domain Number 1 Region: 438-690
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-41
Family YWTD domain 0.00000547
Further Details:      
 
Domain Number 2 Region: 323-410,691-727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000122
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 118-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 241-281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 162-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 39-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 7 Region: 202-243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 3-34
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 86-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 289-322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012429   Gene: ENSCSAVG00000007300   Transcript: ENSCSAVT00000012573
Sequence length 829
Comment pep:novel reftig:CSAV2.0:reftig_7:2343704:2363234:1 gene:ENSCSAVG00000007300 transcript:ENSCSAVT00000012573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENNKFLCDNGNCIWHAWRCDKENDCKDNSDEVNCENKTCNVDEQFRCANGLCVSKRWLCD
GDDDCKDNSDEDQVMCSNRTCNSTGQDFQCTLGKSCISSSWVCDGEDDCVDGSDELGCVQ
PTCLSTEYRCAQGGCITNRWRCDGELDCEDGSDESGCPPRNCSAKNEFRCSSHQQCIPLS
WKCDKDPDCEDGSDEHNCPVKPTPICPSGYFSCEFGFPACIIKTWKCDGEEDCSGGSDEK
NCISVSCRNDQFACDNHHCIAQSLVCNGVRDCNDASDEHDCKGLTPKCDPVRMYQCKDGT
CISKSRLCNHRHDCPNGEDEQEGFLKCNYNECLVNNGNCSDTCVDQRFGYQCQCSPGFQL
NEDGRMCDDTNECLQKRSVCMEMAQCINYKGGYKCECYAGYQMERGRCKPTGDIEDSEFV
TLVFSNKIDIRRLRVHSNLKTRFMTVIADQLKHAIGLSLNIKKRQVFWTDLRDENVLSVS
MNRTDTNNLKSVKTVLSNHEVRSPISLAVDWVNDHLYWVDYSLGTVSLAYSNGDFPTTLL
TLKPMSLRSIAIHPEDGIMFLTVAKAGKWLIMKCAMDGTDCMDVITENIKEPTSITIDYQ
EQRLFWLDGKLNTMSSCDFDGGNRRTVLSVFNYLQHPFGISVGLNEVYWTDVMAHSVLKC
NKWTGNNVTVIDSHLHFPMDIHVDHPTAQPEMQNHCIDNSCQFMCIPLPSGGAKRFTCVC
PDGYVMQDSCVKGTNKIIVATTQAAVSNAQTGWSRIIVLIIFLGCVAFRWYQRRSLQMSM
HFDNPVYRKTTTVNSEEEDHHVGIPRSGSQAHLITNEQFEEPERENDSV
Download sequence
Identical sequences H2Z4B7
51511.ENSCSAVP00000012429 ENSCSAVP00000012429 ENSCSAVP00000012429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]