SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012617 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012617
Domain Number 1 Region: 470-684
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-38
Family DBL homology domain (DH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 160-301
Classification Level Classification E-value
Superfamily PH domain-like 5.62e-35
Family Third domain of FERM 0.00094
Further Details:      
 
Domain Number 3 Region: 824-971
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-30
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 4 Region: 670-790
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-24
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 5 Region: 52-159
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-21
Family Second domain of FERM 0.00024
Further Details:      
 
Domain Number 6 Region: 3-52
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000031
Family First domain of FERM 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012617   Gene: ENSCSAVG00000007404   Transcript: ENSCSAVT00000012761
Sequence length 987
Comment pep:known reftig:CSAV2.0:reftig_7:2412936:2430713:1 gene:ENSCSAVG00000007404 transcript:ENSCSAVT00000012761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDINVLESDYFGIQYEDKGNLVFLDPLKKINSQIKNISNVVLRFVVKFFPPDPGQLQEE
YTRYLFALQIKQDLVNGLLPCNEGTAVAMCSYIAQSEFGDWNSYDCSDLSYLNDLALLPP
LADLSKQELLGKIAESHKIRTGESKADSDFHLLDIVRRLEQYGLRLLPAKDQENTDIKLA
VAHMGVLVFRGNAKINTFNWARIRKLSFKKKRFLIKLRTETSVDNVGDILVFVMASRDTC
KNFWRHCIEYHAFFRLDLHPAPAPKPKIIKRGSTFRYSGKTQKQLHDLVRNSNFRRTTFA
RKSARTPTIHSRPTPYAPAVAVTPAANEFVSLPQNCGHVDVTPPNTNDNSEISRGTIKST
TSVDSPASRASKSSVARSSSTRSGSSSSYKYSNQPLPPFPPPPPSLSVDKLDQRTNRTPA
RPLSSSLDVLSMPDDENSFCILPDPVNNNSGFGRNANNNESFGPGYPSSQAYYIAKEILT
TERTYVKDLEVITKWFKSALQKESSDFLLPENLANQLFGGIGSLVALHQQFLCTLDDRLS
SWEGRGSTGASNDQLVDDLMLNHMLVLKKYLGSLENGESLILALEETGEDSRFESIYREF
ELQKVCYLPFNSFLLKPMQRVVHYKLVVERLIGYYEDDSSMDNHSDLQTAYQEATALATA
IQERLKRAHNLQKLAQLRRDLLGVDNLIKAKRDFIREGSLYKLSRKGFQQRLFFLFSDCL
VYTSKGVTSTNQFKVHAELPLQGMIIEVNEGESAVPNCFSILSGTKTVIVAAATQEEMDK
WLEDFSVAIALAGRDTTLFDSPLNNTTGFSQTSMIPPGSMSRLSMEQSSEDGEGSVRNSM
ERLKPPMQHRSNATMHVCWHRNTSVSSSDHLVSLRNQLSGYLLRKFKNSNGWQKLWVVFT
NFCLFFYKSHQDESPLASLPLLGYTINSPSENDGIRKDFVFKLKFKTHVYFFRAESQFTY
NRWLEVVSSATVTSQRTRLFSRMDSYQ
Download sequence
Identical sequences H2Z4V5
ENSCSAVP00000012617 51511.ENSCSAVP00000012617 ENSCSAVP00000012617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]