SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000014372 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000014372
Domain Number 1 Region: 58-136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.0067
Further Details:      
 
Domain Number 2 Region: 124-197
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000303
Family VWC domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000014372
Domain Number - Region: 262-307
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00144
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000014372   Gene: ENSCSAVG00000008422   Transcript: ENSCSAVT00000014537
Sequence length 395
Comment pep:novel reftig:CSAV2.0:reftig_58:1230993:1235309:-1 gene:ENSCSAVG00000008422 transcript:ENSCSAVT00000014537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KENVSVFGGKQGSDPEVKVAVSDDSALFVATSGVLQLYKSSQMSILFIGTFASVFALCPR
VCDCQSEPRSCQVGVSLVTDGCNCCKVCARQVGDECNDQEKVCDPHRNLFCDYSGSRSGD
LGVCRAQNGRPCMHDGTRISSGSMFQPSCKLRCWCMDGAEGCMPLCAHETQVPLAHLCPN
ARLQPVQGECCSRWVCDSPDYVSDTEAGDVPDTVLPLTPAGELGSNIPDDVVYESDVLLV
LLSITTRTIASSVARGRGHRRSGCRQQASMWSHCTKTCGLGVSTRVSNANTECKLKREVR
LCEVRPCHQAQSLTPKYGKRCMKQKRAPHKEHIVYSGCRSVRTYKPRYCGLCKADDRCCT
PKTTRTSTVRFECEDGRAFYKRVMVIKSCRCHRYC
Download sequence
Identical sequences H2Z9V7
ENSCSAVP00000014372 51511.ENSCSAVP00000014372 ENSCSAVP00000014372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]