SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000014812 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000014812
Domain Number 1 Region: 268-282,373-622
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-50
Family Nuclear receptor ligand-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 200-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-28
Family Nuclear receptor 0.0000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000014812   Gene: ENSCSAVG00000008663   Transcript: ENSCSAVT00000014985
Sequence length 683
Comment pep:known reftig:CSAV2.0:reftig_7:2839792:2848582:-1 gene:ENSCSAVG00000008663 transcript:ENSCSAVT00000014985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMLESDLHVVASSENLARQQEYSSSDMLVKCASVNDDSLGRKRINETTFRSSNSDIEG
QEKMYLVRTESDESGNEGQSLDTVGLADNPSLSIATSHHSEHSVSDMIVSSPNPQPCISA
LSGNPLIGNHTQVLTLDQLTPERLIELQNKGLIQIASVASSPFLVSGRSNSLGGSSPNQP
LSIATYPMKQNEEEVYLGHDLCVVCGDRASGRHYGAKSCEGCKGFFKRSIRKKLTYTCRG
NRDCSVNKTHRNRCQYCRFQKCIIMGMKSDSVQCERSPMHKHDDAHHRLLGNSSEHFIKA
FNKGILNRGIDGESSISGKESPEKHNQGNLSTLANVVSSIANFTKQEREFHSPEKNGRTE
KPVDLAKALASLNSTLKRCSPSEDYLLQTQTPILDFEGPLMTESNFLFELSMPTPSPDVF
NVHYVCESASRLLFLSAQWARSIFAFQLLRAECHTSLLRDCWHELFVLGLAQCSRSMNLD
RIISTIIRHLKTTLQQGKLSSTHVCNVSEHLNKLQDFVARLQKLEVDPHEFAYIKALALF
SPDHVNQVHRTQIQRFQSRAITELREHEVRNYPEDPDRTSLLLLSLPSLRSLNSSITEEI
FFAGLIGNVQIDSIIPYILKMETGEFSTVSEASPVPDLGQYAHDSVLVAEYHNSELLSQN
DYAIEGHAQENLLHTTSTIQTSL
Download sequence
Identical sequences H2ZB47
51511.ENSCSAVP00000014812 ENSCSAVP00000014812 ENSCSAVP00000014812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]