SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000018392 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000018392
Domain Number 1 Region: 97-206
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000068
Family Second domain of FERM 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000018392   Gene: ENSCSAVG00000010800   Transcript: ENSCSAVT00000018592
Sequence length 220
Comment pep:novel reftig:CSAV2.0:reftig_16:2747382:2751726:1 gene:ENSCSAVG00000010800 transcript:ENSCSAVT00000018592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGVERSLELRHGSNSTVSDVIDGLRLSPESKMYFSLWITSKSLHLQLKSDHSPLIEMKK
WPELLRQLSGVRRNVAEDEHPRVVLKRDVNLMPNVEEAVRDIFSTRLLYEEARAQVLRGL
YPCLDQVAVAMAAVVMRILHGPFDAKKHKPSFIGDEIIRQILPNYKLYNRAINWPHKVLQ
QYKEVSEQGPGEISQLQLLYLRYCWTQISTYGSAFFTGYA
Download sequence
Identical sequences H2ZLC6
51511.ENSCSAVP00000018392 ENSCSAVP00000018392 ENSCSAVP00000018392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]