SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000001647 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000001647
Domain Number 1 Region: 413-679
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-39
Family YWTD domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 38-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 129-165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 311-403,673-724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 90-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 172-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 208-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000641
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 289-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 9 Region: 1-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000956
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000001647   Gene: ENSCSAVG00000000951   Transcript: ENSCSAVT00000001674
Sequence length 724
Comment pep:novel reftig:CSAV2.0:reftig_286:45617:60946:1 gene:ENSCSAVG00000000951 transcript:ENSCSAVT00000001674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSNDQFDCGPDQHLRCVAYIYTCDGIPHCSNAADESPVYCHTRSCSFGMFKCTDGKCIPM
NWKCDSELDCDDGSDENCSNPTPFQLTDETCPLGHFQCETSHKCIPLSYHCDADKDCFDG
SDEVNCSSNCREDFFSCADNGHCIPNTWVCDGEVECTDGSDELSCGKFKSGNTDKFRCGD
GGCISAEWKCDREFDCEDHTDEHGCAILWDCKHGYLECKSGNECYSPEWRCDGDSDCTDG
TDETGCPPAPTTGCRVGQVICGDGRCMGISLYCVLPKFKDASIYKECKYMPCFHTGSCIS
IDRACNNVSDCLDGSDEKNCFVNECENKQSNRCQQICVEPVIFYACTCKPGYEINGDGYS
CSQSNECARAAPVCAQVCEVLEGGHECRCAPSYHRDPTNRRNCKAGSHTGKPYLLYSTRY
HFRESLLNGSGNHLRLVNLTDARVLDFDWPGQKIYWADRTNEGSVIRRTDLNKFVSSVET
VHKSLNHVEGLAVDWLGRNLYWTDEGEKTIKVSKLDGSFQKILVKFGLDKPRAIALLPDK
GYMYWTDLGKDPHIGRVGMDGKDRSVIIHNTLLGWPNALTIDYASRKLFWADSKEDYIAH
CELDGSNAIIVWQTSAAESSAISAISVFEDKLIWSELHKGSIMTSYTFASIHNGTFPHKA
KQLQHSQITDLKIVHPLRQPMPMNPHPCSVDNGGCSDLCLLAPSGERSCACPEGFILDTH
GLTC
Download sequence
Identical sequences H2Y8J9
ENSCSAVP00000001647 ENSCSAVP00000001647 51511.ENSCSAVP00000001647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]