SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000002216 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000002216
Domain Number 1 Region: 137-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.24e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000002216   Gene: ENSCSAVG00000001303   Transcript: ENSCSAVT00000002254
Sequence length 232
Comment pep:novel reftig:CSAV2.0:reftig_5:1618035:1618733:-1 gene:ENSCSAVG00000001303 transcript:ENSCSAVT00000002254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTVPDSSENQNTNFTVVQSRKRKLKAANMETEDSKRPHFPSISGEKLLSGKSSFRKIPI
PSNRYTPLKENWMKIYTPIVENLRLQIRFNLKSRNVELQTSPETTDIGSLQRAADFVKAF
VLGFSVEDSLALVRLDELFLESFQVTDVKRLKGDHLSRAIGRVAGSGGRTKFTIENVTKT
RIVLADTHIHILGSYQNIRLARTAICNLILGSPPSKVYGNMRAVASRSVERF
Download sequence
Identical sequences H2YA68
51511.ENSCSAVP00000002216 ENSCSAVP00000002216 ENSCSAVP00000002216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]