SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000002477 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000002477
Domain Number 1 Region: 1448-1683
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-42
Family YWTD domain 0.0000128
Further Details:      
 
Domain Number 2 Region: 396-629
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-39
Family YWTD domain 0.0000123
Further Details:      
 
Domain Number 3 Region: 3179-3443
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-37
Family YWTD domain 0.00000648
Further Details:      
 
Domain Number 4 Region: 1730-1997
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-36
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 5 Region: 2375-2606
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-35
Family YWTD domain 0.0000305
Further Details:      
 
Domain Number 6 Region: 707-921
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-32
Family YWTD domain 0.0000441
Further Details:      
 
Domain Number 7 Region: 2049-2326
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-29
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 8 Region: 4084-4308
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-29
Family YWTD domain 0.0000597
Further Details:      
 
Domain Number 9 Region: 268-361,623-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 3008-3049
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000209
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 11 Region: 1047-1086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 12 Region: 3608-3647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 13 Region: 1256-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 2714-2756
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 15 Region: 1089-1126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 16 Region: 3730-3774
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 2881-2918
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 18 Region: 196-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 3124-3172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000523
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 20 Region: 2969-3008
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 21 Region: 3772-3812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 22 Region: 159-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 997-1037
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 2679-2716
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 25 Region: 77-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 26 Region: 3052-3089
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 1130-1167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 28 Region: 3091-3139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000369
Family EGF-type module 0.014
Further Details:      
 
Domain Number 29 Region: 35-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 30 Region: 3820-3858
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 31 Region: 3697-3734
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 1215-1250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 3492-3528
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 2836-2876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 35 Region: 3529-3569
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 36 Region: 2799-2838
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 37 Region: 240-276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 38 Region: 1372-1418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000339
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 39 Region: 3906-3944
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 40 Region: 1-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 41 Region: 1686-1723,1993-2043
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000926
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 42 Region: 3989-4030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family EGF-type module 0.007
Further Details:      
 
Domain Number 43 Region: 1171-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 44 Region: 2924-2967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 45 Region: 3573-3610
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 46 Region: 121-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000105
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 47 Region: 3662-3694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000367
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 48 Region: 2754-2796
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000484
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 49 Region: 2331-2378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000565
Family EGF-type module 0.023
Further Details:      
 
Domain Number 50 Region: 1298-1336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 51 Region: 3862-3896
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 52 Region: 4363-4395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000475
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000002477
Domain Number - Region: 1339-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00286
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 3450-3509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0182
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 3954-4002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0572
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4315-4350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0695
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000002477   Gene: ENSCSAVG00000001468   Transcript: ENSCSAVT00000002518
Sequence length 4433
Comment pep:novel reftig:CSAV2.0:reftig_55:1302239:1358029:-1 gene:ENSCSAVG00000001468 transcript:ENSCSAVT00000002518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPSDQFECENGACIDLSWVCDGVTDCLGETVPGSDEEDCPAASCRSSEFQCSDGSCILSE
FRCDGDPDCSDGGDEQACPGATCSSSEFTCANNYCIDADLKCDHVNDCPDNSDEQGCSYP
TCDELKCKNGACFTSAQRCDGNVDCRDESDEFNCSESSTQCSSNEFQCDNGKCIPQSFYC
DVWNNCGDGSDEPDGVCVYPSCPGNTFTCDNSVCVNQEWVCDGTDNCGDGSDEENCDYAI
PCLNNQWRCTNSSRCINVVQICDGKIDCEDGTDESQTGSVCSSTKCGILSCDGYCRATPQ
GGTCYCDDGYQVGDDGISCKDFDECTVFGQCEQKCENTVGSFKCGCADGYIPEQSHDHLH
CKATPTAGAPRLLFSAGPNIYFNDFLNDKLDIAVEAGSPIGVDYHYELGKIFWSDAILQK
VMSANTDGNNQKVILDKAISDPEQVAVDWIGNNLYVVETKVGRIDICNFDGSHRTGVVTN
GLRNPRGLALDPTKGYMFFTDWYTTTARLDRAYMDGSELYTIVDTSVGYPSGITVDFTNS
RVYWVDTKFDYVETVDYNGKNRRTILSGSHLLPWPYDVTLFEEHVYISDATKLGILRGNK
FNGSIDYALVTKTGVIPNGLIAYHPSRQPKVDNPCAVQNGGCAHLCVLSHVLDGLGYSCL
CDLGYVLNMDRKSCKHSDDFILAASYGSIQGIPTGRFQQTDAMLPILSNGQQYFMSVTSD
AVNGYIYYGENGKDIIYRTLMNGTGKAEEIVTNRVRLIRALALDWTTGNLYIVDSSMDRI
TVVNTKDPTNLRKTVVSGDVWSPTSIAISPNRGYMVWTDTYRPARIERAWMDGSNRMSLV
NQTLYYPQAITIDLVTGYVYWIDSGFDRIERISINGYSRKEVLVSQAISYPRAITFLNDY
IYWYDGRYNSLFRVPDFVTSQTLQTETVRSGLYSVYTLDAFNKDIQNRYMNNQCNRASLP
NGGCQLLCFPAPLNSRTCGCPDNMLPDGNNCRPNPHVTPEPPCSSYQFQCANEKCIYTSY
RCNGIDDCGDNSDEDDELCGQQIIYFKGGTCRSYQFQCNNGKCIYTSWKCDGDDDCGDNS
DEAGCPSTRPCSSYNFQCDNGQCIPKSWVCDTDNDCGDASDEKDCELFDLKTCSSTQFTC
SSHLCISQYLVCNGFDDCPDGIDENDCPDVTCNPQYSFACADKKQCVSKTYKCDGHPDCR
DGSDEQGCPSKPPGYCESNEFQCQTSGMCIPSGWFCDARVDCDDGSDEPPTCPDTTCRSY
QFKCKNRVCIYNSYVCNGDNDCGDNSDEEDCPTPPPTLPPPPCGTMDFECPGTKKCISYN
KVCDGVEDCSFGTDEDTFCDADLCSGFGCTDQCVNLPTGPLCWCDGSGYELLNDSKTCAD
IDECARRYCSQACDNTEGSFYCKCDSGYQLDTDGRTCKVTSKLFCKVSKPYGRPLTPFVG
DRNSFLIHIRNLLGNDFDWATRKIYYADTYYGNLYKAFLNGTMREIVFSSGTSITENIAV
DWVARNLYWCDYDLGTIEVARIDGTHRAILHAMNVTNPRGLALDPRDGYHYLFWTDWGQN
PRIERCDMDGNHRKSIITDRLFWPNGLTIDYPNTMVYLDAKLDFIHRCGYDGQDRTEVLA
GTNFIRHPHSLTILEDYLYWTDRETYSVSRCNKWDGSKNQTKVMTGLYYPTDLHAFHPVR
QPAGTNYCEGNPCSHICLLGNFRPRYYTCACPVGSSLTDTHTCTPNQDDFILVSTPGRIF
GIALDPEDQESDKMIPVTNIVNGMDVEHDDSQGWVYWVDTRYKTIERIHVTGTNKSTFAY
GNLLGLSELAFDWVSRNMYYTNPDAKHIEVIRVDPGNNRQYYRRTIIGNIGNETGVANPI
GLAVDPQNGKLYWSDQGGDGIPPKISRCNMDGSYIENIITTSVNNIQHIALDYSGGRIFW
AEQNSGSIMSATTDGTDIRTIVDNVIRPMGLTVIGDYIYYSDLSLQLIERADKTNGNNQQ
ILRSDVEDVTSLKIFNRPLSLANDCSKTINGGCQQLCFVVGGSRRCSCSTGFTLNGDGVT
CSSSDSFALVSLGNNLRGFNLDGASHVDAMPPMFSSYWNSSFVGVDMKQQKIMWSSYRRG
GSTSGGYLGYLFNVVYAADRDNGYARQVVIGGIGSRGITGFAYDWVSQNIFFLNGFTRET
YLEVGTYNRRYRLILIKIVDDMPVAIAINPLKRLLYWADYGQVPKIESAYMDGTNRTILA
TSGLTQPRSIVIDYSTHDVYWCDEQSSTIEKMSWDGSNRVTIRSGRNYPSPRGVAVYQDY
IYWVDPTWKSLFRASTDPSNQDDPEKLRDGLENPQDVAIYDQSIQPDDPSNNPCANNNGG
CSQLCIALPDNSRVCKCAFGKIGNDGTSCNDAEDYVVFTTTRDISGFHVDPDDHSLIFPT
VTASYPIAVAHDLQDNRAYFATRQGSYSRIGYIDLNSNPSYPKYVVTSGLRGPEGTCLDF
DWVHRKLYYTDNSLKIIGSVSPDGSNMTTVVSGLNLPRGIAVDPCRGYIYWTDWGTHTIE
RSTLVGNGRTVIVSEDLLWPNGVTIDFDEDKLYWVDAEPKERVERSNMDGTERELIIPSL
DHPFAIAILDQFVYWTDWSTRGVYRWIYYEILMIKHLYGFLLSIVHTASPLHRFNGGCSD
ICSIGPSNTAECSCPIDDGKKYYLANNGKDCIEDTGQDRCNANQYTCSNGICRPLSWVCD
GYTDCSDGADEAERTCADHTCESHRHRCPNGRCIPISFVCDFDDDCGDGSDEQGCPTPTC
ASDEFECLYGRCLSISQVCNGYDNCRDGVVSDEKDCNHTTCRPGYHKCTNTNVCIYGGWL
CDGDNDCGDNSDEAPVFCAGKTCRSGQFQCDNVYQCIPLTWYCDDYNDCDDGSDEPTQCT
HPDRTCPQGAFTCDNGRCINIDWVCNGVNDCNDNSDEDERQDCGSRTCQSTEFTCEGNPP
GHSRCISRLFVCDGDIDCEDGADELQPECPPTICNENQFNCTNGLCIPKYYVCDHDNDCG
DYSDEYGDCVYQTCSSYQFTCENGKCIPKSWTCDGRNDCTDNSDEVSCPTGPPTCGPDMF
MCKNGQCIDMGVVCDRNPDCSDRSDEERCGLNECATIASNQCAQLCVDTLTSYYCDCNPG
FRLLADGKACEDINECIETPWVCSQLCDNIEGSYYCKCGSGYLREPDGVTCRQNSGIEPY
ILFSNRYYIRKIAVDGSDYELVKGLDTVVALDYDYQGQRMYWTDVTAKQIGSMKFDGTDK
KTLFHREVPDGEGLAVEWVTGKLYWLDATLRALHVSELNGTSKLTLMKGCIDVNRTYCFH
SPRALALHPKRSLLFWTDLGLKPYIAKAYLNGDNAQTVITTVVGWPSALTIDYVTERIYW
GDAHLNAIQFSDMDGNNRHRLYLNGLNQPMAFAITFFESYIYWTDYSTYSMYKAHGLDGS
NLQRLVNSTHRQYDLHVVHPYRQDNRLTNPCEMNNGDCSHLCLMAMDGNKECKCPDNFVS
VSVGITGTRCFPACTSAQYRCDSTEKCIPIYWKCDGVEDCPDGSDEPDTCPPRSCPIGYF
QCVDYGCVKPEYMCDGDNDCDDGSDEVNCDDYPCLDTQFKCGNGKCLSNSRVCNGFDECG
DNSDEDADMCAQHTCPVGHFQCDNGRCIPSNWWCDVDNDCGDGSDEPVAVCASDQHVCRP
ELDFACKTNYRCVPKYSMCNGIDDCYDNSDEEQCSQMTCDPNNDYQCPNFRCIPLRWRCD
DYNDCGDNSDEVGCAPRQCSESEFRCDNLQCIPGDWVCDQYDNCGDGSDERGCTAATCST
GFFECTSGHCVPSSVVCDGDRDCLDASDEAACVPKFPGGRYCPNNRFQCDNHVCVNLNFR
CDGQNDCGDESDEYPSVCESIDCVSPKWRCEKTRLCIFENQKCDGKDDCKDGTDETIEMC
HPTTVAPTCTYVQFKCFNGKCVSELVVCNDVDDCGDQTDESGCHKGDTTHTCADKPCEQV
CTTIPSFGDIPGYYLCSCNDGFTVSGFNDNTHSCDDINECFESWSTCSQICRNTKGSYQC
ECGDGYVLSGTTECSAEGFSMMLIADEQDVITYDVLNDKEAKLVQRQLRMGAMDYAYLGG
NQSVLIWTDTATHTVKPKIVRTMMPYMDGSTNNFGISQDLAVPGLTKPNGIAVDWVTQNI
YWTDETAGSITVSLLDGRYPKTLIDRIDTPRAIVVNPKSSYMFWTTLGLTPAIYRSHMDG
GSIIQLDDVVVGYPTGLAIDYQHGGRLYICDEQADRIIAVSQHGHNQVNIARGAGNPISV
EVFENTVYWTTSDKSLYRNEKFGRGVKKLLRRGLKSASDIKIYHPSRYESGMAQRCKADS
CSHLCLLSPGSYTCACPDGSSFFPGSARQCDASYVAPLPQLSVCQCRNGATCTYDENSMP
VCLCASGYFGVNCENGASVPLPSLADGGIIAAVVVIMVVIGVAGFFYFRKKNS
Download sequence
Identical sequences H2YAX9
ENSCSAVP00000002477 ENSCSAVP00000002477 51511.ENSCSAVP00000002477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]