SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000005560 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000005560
Domain Number 1 Region: 191-285
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000717
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000005560
Domain Number - Region: 36-186
Classification Level Classification E-value
Superfamily PH domain-like 0.00143
Family Pleckstrin-homology domain (PH domain) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000005560   Gene: ENSCSAVG00000003317   Transcript: ENSCSAVT00000005634
Sequence length 300
Comment pep:novel reftig:CSAV2.0:reftig_46:142454:158099:1 gene:ENSCSAVG00000003317 transcript:ENSCSAVT00000005634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAHPPPFAPQYNPTAPEIMLMQQNFGFNDQQFNSVPEQGNSHIHPNEAPPQYTPSVPV
PAYQIQDPIPNRPPIPSRAPTTNTTPAVVAPLRTKCGFVDVGVGELTDVDGSRAYRRQYV
EVTDGVMRMSASRDLRVQANTIQLASRFVSMETKKNIAIQDGASTFVIRAQSDASALKWM
LVLAQYCFVAPIMEGFAQKQTGGKNVYEERFLRLYSDGVLAWYGSDNENSDRHGAIQVRG
ENCVIDSANLKCVRINVKTRDYQFRFFDEREASLWHAAFQWHSARKPLKKASIPIRNKAR
Download sequence
Identical sequences H2YJR1
51511.ENSCSAVP00000005560 ENSCSAVP00000005560 ENSCSAVP00000005560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]