SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000006025 from Ciona savignyi 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000006025
Domain Number 1 Region: 603-699
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-22
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000006025
Domain Number - Region: 116-318,603-623
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000167
Family BAR domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000006025   Gene: ENSCSAVG00000003593   Transcript: ENSCSAVT00000006102
Sequence length 713
Comment pep:known reftig:CSAV2.0:reftig_11:234106:239667:1 gene:ENSCSAVG00000003593 transcript:ENSCSAVT00000006102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAEFMDTTMKKDKESEKLSKDENASPAAASKMPCNYRRLESFEGDIWKQPLPVMNAYSG
PIDTSTDDLTQRTIRACEDADRTLQADDNIMFAKSVRKIPTADVAEIQRLREQGLSRIEA
VQRKICELEVQLSESTSELDMERALIAGELSSEKTNLTADERSCDELKDQIISLEEEYIA
HREKHQGIVDKEKRKLQQIQKKVSETRKQMDKCPESMRGSIEATLQKEQEELEQESRRFE
DAEFNSLETMSRLDEEKEVMQRTLIRRKRKLEMQIDNRKGRVASLQQQLDDITAQQTQEN
QRLNNERDEAIGSLQGQREETTLLERKYYQLTGEFPPSVDTPVSLARSHRRMSSTTSSRS
DVFKRQISSSSSKVDTTKIFNFSSSTDLLSNASKSRPLSGDKSMGYNEFDRSSPISTRNN
DHLMALQQQIREGQTSLSPVTTSLLSSRQKLNSSASPIYQRLNSTNGQSRATSADKWKDT
TSISSMDSLDTTLSTWSIQSPESHDIEKLLEMEQLIADATAEKKRLLAEVGQKLPPNTSP
TTSPSHEEMSQVKLRSSNGDRRQARPMTRYLPVRGSDFNLRHHIESCGHNPSACRHLSIN
ATSCRGYMTKMGGRIKTWRKRWFVFDRISKTLSYYSDKHEIKLKGMIYFHAMEDVFFDHL
KGHKSPNPSLTFCVKCFDRIYYLVAPSCESMRIWMDTLVTGSEGYREYMKTFE
Download sequence
Identical sequences H2YL23
ENSCSAVP00000006025 51511.ENSCSAVP00000006025 ENSCSAVP00000006025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]